SecReT4
Protein ID: 126698080
T4SS name [ID]Tra_Tn [668]
Gene symbol-
Locus tagCD630_05020
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]590560..593007 [+]
ProductATPase
Component typeOrf16_Tn
UniProt IDQ188U4
KEGG IDcdf:CD0502
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1e-33, Aligned region: 468..763
Protein Sequence: 815 a.a.     [Download]
>gi|126698080|ref|YP_001086977.1| ATPase [Clostridium difficile 630]
MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHALQISTESSIR
SAQERSKNEVTGKLKAIAYDKIDQQTDALISMIGENQVDYRFFIGFKLLLNDQEFSMKSLTVEAKNALSD
FVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFKIRRLNKDDFGYLIEHLYGQTGTAYEDYEYH
LSKKKLDNETLIKYYDLIKPTRCLIEEKQRYLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQF
TFPIDTSMNVEIVANCKALSTVRNKKKELKDLDNHAWQSDNETSSNVAEALDSVNELETNLDQSKESMYK
LSYVVRVSANDLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFLAGL
GFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFANNLIVYYAVL
YGAQAVIVDPKAERGRWKETLPEIAHEINIVNLTSDEKSKGLLDPYVIMKNPKDSESLAIDILTFLTGIS
SRDSERFPVLRKAIRAVTNSEVRGLLKVIEELRVEGTPTSTSIADHIESFTDYDFAHLLFSDGYVEQSIS
LEKQLNIIQVVDLVLPDKETSFEEYTTMELLSVAMLIVISTFALDFIHSDRSLFKIVDLDEAWSFLQVAQ
GKTLSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKNNLGLKFAFRSTDINEIKKTLAFFGVDPEDENNQK
RLRDLENGQCLISDLYGRVGVIQFHPVFEELLHAFDTRPPVRKEV
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|126697566|ref|NC_009089.1|:590560-593007 Clostridium difficile 630, complete genome
ATGGCATATCCAATTAAATACATTGAAAATAATCTGGTCTGGAATAAAGATGGCGAATGTTACGCCTATT
ATGAGCTTGTTCCTTACAATTACTCATTTCTAAGTCCAGAACAGAAAATACAAGTGCATGATTCTTTCAG
ACAGCTTATCGCACAAAATCGTGATGGCAAGATTCATGCCTTACAAATCAGTACAGAATCCAGCATACGT
TCAGCACAAGAGCGTTCTAAAAATGAAGTCACTGGCAAGCTCAAAGCGATTGCCTATGACAAAATCGACC
AACAGACAGACGCTTTAATATCCATGATTGGCGAAAATCAAGTGGATTACCGTTTCTTTATCGGCTTTAA
GTTGCTTCTCAACGATCAGGAGTTTTCCATGAAAAGTCTTACCGTTGAAGCCAAAAATGCTTTGTCTGAT
TTTGTCTATGATGTGAACCATAAGTTAATGGGAGATTTTGTCAGCATGAGTAATGATGAAATCCTGCGTT
TTCAGAAGATGGAAAAGCTCTTGGAAAATAAAATCTCTCGTCGTTTCAAAATCCGCAGACTGAATAAGGA
CGACTTCGGCTATCTGATTGAACATCTTTACGGACAGACAGGTACAGCTTATGAAGATTATGAGTATCAT
CTATCAAAGAAGAAGCTGGATAATGAAACCTTGATTAAATACTATGACCTCATCAAGCCTACTCGCTGTT
TAATAGAAGAAAAACAGCGATACTTGAAAATCCAGCAGGAAGATGAAACCGTCTATGTGGCTTATTTTAC
CATTAACAGTATTGTCGGAGAGCTGGACTTTCCATCAAGTGAAATTTTCTATTACCAGCAACAACAATTT
ACCTTTCCCATTGACACGTCCATGAATGTGGAAATCGTGGCAAATTGTAAAGCATTAAGCACCGTTCGCA
ATAAAAAGAAAGAGTTGAAAGATTTAGATAATCACGCATGGCAAAGTGATAATGAAACCAGCTCCAATGT
GGCAGAAGCCTTGGATAGTGTAAATGAGCTGGAAACCAATTTAGACCAATCCAAAGAATCTATGTACAAA
CTCTCTTATGTGGTTCGGGTTTCTGCTAATGATTTGGACGAGTTGAAACGTCGCTGTAATGAAGTGAAAG
ACTTTTACGACGATTTGTCTGTGAAACTGGTTCGACCTTTTGGCGATATGCTGGGCTTACATGAAGAATT
TCTGCCAGCAAGCAAAAGATATATGAATGACTATATTCAATATGTAACTTCTGATTTCCTCGCTGGACTT
GGCTTTGGTGCTACGCAAATGCTGGGCGAAAATGAAGGGATTTATGTTGGCTATAGCTTAGATACAGGAC
GCAATGTGTATCTCAAACCAGCGCTTGCCAGTCAAGGGGTTAAGGGTTCAGTAACCAATGCGTTAGCGTC
GGCTTTTGTTGGCTCGCTGGGTGGTGGTAAATCCTTTGCGAATAACCTTATCGTCTATTATGCAGTGCTT
TATGGAGCACAAGCAGTGATTGTTGACCCAAAGGCGGAACGTGGCAGATGGAAAGAAACGCTTCCAGAAA
TCGCTCACGAGATTAACATTGTGAATCTCACTTCTGATGAGAAAAGCAAAGGACTGCTTGACCCTTATGT
AATTATGAAAAATCCAAAAGATTCTGAATCACTGGCTATTGATATTCTGACATTCCTTACAGGGATATCC
TCACGAGATTCTGAACGTTTTCCCGTACTACGGAAAGCGATTCGTGCAGTAACCAATAGTGAAGTGCGTG
GACTTCTTAAAGTCATTGAGGAATTGCGGGTCGAGGGAACACCAACAAGCACCAGTATCGCTGACCATAT
CGAGAGCTTTACGGATTATGATTTTGCACATCTCTTATTCAGTGATGGCTATGTCGAACAATCTATCAGT
CTTGAAAAACAGCTCAACATTATACAGGTGGTGGATTTGGTATTACCTGATAAGGAAACAAGTTTTGAGG
AATACACGACAATGGAACTATTATCCGTTGCTATGTTAATTGTCATTAGCACCTTTGCGTTGGATTTTAT
CCATTCAGACAGAAGCCTTTTCAAGATTGTAGACCTTGACGAAGCATGGAGTTTCTTACAGGTGGCACAA
GGTAAAACCTTATCTATGAAGTTAGTAAGAGCTGGACGTGCTATGAATGCAGGTGTCTATTTTGTTACTC
AAAATACAGATGACCTTTTAGATGAAAAATTGAAAAATAATCTTGGTTTGAAGTTTGCCTTTCGTTCCAC
TGATATCAACGAAATTAAAAAGACCTTAGCTTTTTTTGGAGTTGACCCAGAGGACGAAAACAATCAGAAG
CGACTTCGTGACTTAGAGAACGGACAATGCCTTATCAGTGATTTATATGGTCGTGTCGGTGTGATACAGT
TCCACCCAGTCTTTGAAGAATTACTTCATGCTTTTGATACCAGACCGCCTGTGAGAAAAGAGGTGTAA
 Primer design