SecReT4
Protein ID: 126700955
T4SS name [ID]Tra_Tn [669]
Gene symbol-
Locus tagCD630_33350
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]3897502..3898410 [-]
Productconjugative transposon protein
Component typeOrf13_Tn
UniProt IDQ180I0
KEGG IDcdf:CD3335
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 7.8e-61, Aligned region: 75..302
Protein Sequence: 302 a.a.     [Download]
>gi|126700955|ref|YP_001089852.1| conjugative transposon protein [Clostridium difficile 630]
MIQIRKEENQKKQKEKKLKVYKVNTHKKTVIALWVLLAVSFLFAVYKNFTAIDIHTVHETKVIEEQILDT
HKIENFVENFAEIYYSWEQSAASIDNRTNALKGYLTGELQALNVDTVRKDIPVSSALTDFQIWEITEEKE
QHYQVTYTVEQRITEGESSKTVRSAYQVTVYVDSSGNLTIIQNPTITSVPVKSGYTPKAVQSDGTVDSIT
TEEINEFLTTFFKLYPTATAKELTYYVNEGVLKPVGKEYIFSELVNPVYNRNGNQVTASLAVKYLDNQTM
TTQVSQFDLVLEKNGENWKIVK
 
Nucleotide Sequence: 909 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c3898410-3897502 Clostridium difficile 630, complete genome
ATGATTCAGATTAGAAAAGAGGAAAACCAGAAAAAGCAGAAAGAAAAGAAGCTGAAAGTCTACAAAGTCA
ATACCCACAAGAAAACCGTGATTGCCCTGTGGGTGCTGCTGGCAGTGAGCTTCCTGTTTGCCGTCTATAA
GAATTTCACGGCGATAGACATTCACACTGTCCATGAAACGAAAGTGATTGAGGAACAAATCCTCGACACC
CACAAGATAGAAAACTTTGTGGAGAATTTCGCAGAAATCTACTATTCATGGGAACAGTCCGCCGCTTCCA
TTGACAACCGGACAAATGCTTTAAAAGGGTATCTCACCGGAGAGCTACAAGCCCTGAATGTAGATACCGT
CCGAAAAGACATCCCCGTATCATCTGCCCTGACTGACTTCCAGATATGGGAAATCACAGAAGAAAAGGAG
CAGCATTATCAAGTGACCTACACGGTGGAACAGCGTATCACAGAGGGAGAATCCAGTAAAACTGTCCGTT
CCGCCTATCAGGTGACGGTCTATGTGGACAGCTCTGGAAACCTGACAATTATCCAGAACCCAACCATTAC
CAGCGTTCCCGTAAAATCCGGCTATACGCCGAAAGCGGTACAAAGTGACGGTACAGTGGATTCCATCACT
ACGGAAGAAATCAACGAATTTCTCACTACCTTTTTCAAGCTGTACCCTACGGCAACCGCAAAGGAGCTGA
CCTATTATGTGAATGAGGGCGTACTGAAACCTGTGGGGAAAGAATACATTTTCTCGGAACTGGTGAATCC
AGTTTACAATCGAAACGGAAATCAGGTGACAGCTTCCCTTGCAGTGAAATATCTGGATAACCAGACCATG
ACAACACAGGTATCGCAGTTTGACCTTGTGCTGGAAAAGAACGGGGAAAACTGGAAGATTGTGAAATAG
 Primer design