SecReT4
Protein ID: 126700956
T4SS name [ID]Tra_Tn [669]
Gene symbol-
Locus tagCD630_33360
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]3898427..3899431 [-]
Productcell wall hydrolase
Component typeOrf14_Tn
UniProt IDQ180H9
KEGG IDcdf:CD3336
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 1e-60, Aligned region: 47..203
NLPC_P60 [PF00877], Evalue: 1.1e-29, Aligned region: 225..330
Protein Sequence: 334 a.a.     [Download]
>gi|126700956|ref|YP_001089853.1| cell wall hydrolase [Clostridium difficile 630]
MKLRHLFFACSGVFVMMFSLLLLVVIVFSDEEDGGSGGNLIYGGVSVSQEVLAHKPMLEKYAREYGIEEY
LNVLLAIIQVESGGTLEDVMQSSESLGLPPNSLSTEESIKQGCKYFSELLAAAETKGCDLNSVIQSYNYG
GGFLDYVAGHGKKYTFELAESFARDKSGGKKVTYTNPVAVEKNGGWRYSYGNMFYVLLVSQYLTVAQFDD
ETVQAIMEEALKYEGWTYVYGGDSPSTSFDCSGLVQWCYGKAGIALPRTAQEQYNVTQHIPLSEAKAGDL
VFFHSTYNAGTYITHVGLYVGNNRMYHAGNPIGYADLTGSYWQQHLAGAGRIKQ
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c3899431-3898427 Clostridium difficile 630, complete genome
ATGAAGTTAAGACACCTTTTCTTTGCCTGTTCCGGCGTGTTCGTGATGATGTTCTCCCTGCTCCTTTTGG
TGGTGATTGTCTTCTCGGATGAGGAAGACGGAGGAAGCGGCGGAAACCTTATCTATGGGGGCGTGAGCGT
ATCACAGGAAGTCCTCGCCCATAAGCCTATGCTGGAAAAGTATGCAAGGGAATATGGCATAGAGGAATAC
TTAAATGTGCTGCTCGCCATCATTCAGGTGGAATCCGGCGGCACACTGGAAGACGTTATGCAGTCCTCGG
AATCTCTGGGGCTTCCCCCGAACTCTCTTAGCACAGAGGAATCCATCAAACAAGGCTGCAAGTATTTCTC
GGAACTGCTCGCAGCGGCAGAAACAAAGGGCTGTGATTTAAATAGTGTGATTCAGTCTTACAACTACGGC
GGTGGTTTCCTAGACTATGTAGCAGGGCACGGAAAAAAATACACCTTTGAACTGGCAGAGAGCTTCGCAA
GGGACAAATCCGGCGGAAAGAAAGTCACCTACACCAACCCTGTTGCCGTAGAGAAAAACGGGGGCTGGCG
GTATTCCTACGGAAATATGTTCTATGTCCTCTTGGTATCGCAGTACCTGACCGTGGCACAGTTTGATGAT
GAAACGGTACAGGCTATCATGGAGGAAGCCTTAAAGTATGAGGGCTGGACGTATGTGTACGGGGGCGATT
CCCCCTCCACTTCCTTTGACTGTTCGGGACTGGTGCAGTGGTGCTATGGCAAGGCAGGAATCGCCCTGCC
ACGGACAGCACAGGAACAGTACAATGTGACGCAGCACATCCCCCTGTCCGAAGCAAAAGCAGGGGATTTG
GTCTTTTTCCATTCCACCTACAATGCCGGAACCTATATCACCCATGTGGGGCTGTATGTGGGAAATAACC
GGATGTACCATGCCGGAAATCCCATTGGTTACGCAGACCTGACAGGCTCCTACTGGCAACAGCACCTTGC
CGGAGCCGGACGAATCAAACAATAA
 Primer design