SecReT4
Protein ID: 126700957
T4SS name [ID]Tra_Tn [669]
Gene symbol-
Locus tagCD630_33370
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]3899428..3901809 [-]
Productmembrane protein
Component typeOrf15_Tn
UniProt IDQ180I2
KEGG IDcdf:CD3337
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 793 a.a.     [Download]
>gi|126700957|ref|YP_001089854.1| membrane protein [Clostridium difficile 630]
MKIRKPIQQGTALVPCRTKGQNSFKKIGSIAGKVLLALLLILLLLTVFGTAAHAAGLVDDTVDAANEYSK
YPLDNYQLDFYVDSGWDWLPWNWLDGIGKQVMYGLYAITNFIWTISLYLSNATGYLIQEAYSLDFISSTA
DSIGKNMQTLAGVTTGGLSSEGFYIGFLLILILVVGIYVAYTGLIKRETTKAIHAVVNFVVVFVLSAAFI
AYAPDYIGKINEFSADISNASLTLGTKIVLPNSESQGKDSVDLIRDSLFSIQVKQPWLLLQYGNSDVESI
GADRVEHLLSTSPDENNGQDREEIVVEEIEDRENTNLTITKTINRLGTVFFLFMFNIGISVFVFLLTGIM
IFSQVLFIIYAMFLPVSFLLSMVPSFEGMSKRAITKLFNTILTRAGITLIITVAFSISTMLYNLSGEYPF
FLTAFLQIVTFAGIYFKLGDLMGMFSLQSGDSQSMGSRIMRRPRMLMHAHMHRLQHKLGRSVAALGAGTA
AYHAGKQAGSDQRTASSSGSSKRTQADHSRPDGQAAPEKESVWKRAGSAVGTVADTKDKISDTAGQLREQ
AKDLPVNAKYALYHGKTQVSEGVRDFTSSVTQTRTARAEQRNAQAESRRQTIAERRAELEQAKQPQQRAS
ETSKGAAPVHERPVTAKQPENFRHHADTAHTGKPAMQPVSPSIREWGQVSYEGAVAERASVPVVKSASIH
REQTPPVRTERQIVPPAFPDKPEERQKTAPTVTPTAPRPARPVQNDTAPVILERKRITPAVKESNFTIRR
TTARKEWTKTVTAAAKQKKGEKP
 
Nucleotide Sequence: 2382 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c3901809-3899428 Clostridium difficile 630, complete genome
ATGAAGATAAGAAAGCCCATCCAGCAGGGGACAGCTCTTGTCCCTTGCCGGACAAAGGGACAAAACTCTT
TTAAAAAAATCGGGAGTATAGCAGGAAAAGTGCTTCTGGCACTCCTGCTCATTCTCCTGCTGCTAACAGT
CTTCGGCACAGCCGCCCACGCTGCCGGACTGGTGGATGATACGGTGGATGCTGCCAACGAATACAGCAAA
TATCCGCTGGACAACTACCAGCTTGATTTTTATGTAGACAGCGGATGGGACTGGCTCCCGTGGAACTGGC
TGGACGGTATCGGAAAACAGGTGATGTACGGGCTGTATGCCATCACAAATTTTATCTGGACAATCAGCCT
GTACCTTTCCAACGCCACGGGGTATCTGATTCAGGAAGCCTACTCGCTGGACTTCATTTCCTCTACGGCG
GATTCCATTGGGAAAAATATGCAGACCCTTGCAGGCGTTACCACAGGCGGCTTATCCTCGGAGGGATTTT
ATATCGGGTTCCTGTTGATTCTCATTCTGGTGGTGGGGATTTACGTTGCCTACACAGGGCTTATCAAACG
GGAAACCACAAAAGCCATCCATGCCGTTGTGAATTTCGTGGTGGTGTTCGTGCTGTCCGCTGCCTTTATC
GCCTATGCTCCTGATTATATCGGGAAAATCAATGAATTTTCCGCAGACATCAGCAATGCCAGCCTGACCC
TTGGCACAAAGATTGTGCTGCCAAACTCGGAAAGCCAGGGAAAAGACAGCGTGGATTTGATACGGGACAG
CCTGTTTTCCATTCAGGTCAAACAGCCGTGGCTCCTGCTGCAATACGGAAACTCGGATGTGGAAAGTATT
GGGGCTGACCGTGTGGAACACCTGCTCTCAACCAGTCCAGACGAAAACAACGGGCAGGACAGGGAAGAAA
TCGTGGTGGAGGAAATCGAAGACAGGGAAAATACCAACCTTACCATCACAAAGACCATCAACCGCTTGGG
AACCGTCTTCTTCCTGTTCATGTTCAATATCGGTATCTCCGTTTTTGTATTCCTGCTCACGGGGATAATG
ATTTTTTCACAGGTGCTTTTTATCATCTACGCCATGTTCCTGCCTGTGAGCTTCCTCCTTAGCATGGTTC
CCTCTTTTGAGGGGATGTCAAAACGTGCCATTACAAAGCTGTTCAATACCATCCTTACCAGAGCCGGAAT
CACCCTGATTATCACAGTAGCGTTCAGCATTTCCACCATGCTCTACAACCTGTCTGGGGAATACCCGTTC
TTCCTGACGGCGTTCTTGCAGATAGTGACCTTTGCCGGAATTTATTTCAAGCTGGGGGATTTGATGGGGA
TGTTCTCCTTACAGAGTGGGGATTCCCAAAGCATGGGGAGCCGTATCATGCGAAGACCCCGTATGCTCAT
GCACGCCCATATGCACCGTTTACAGCATAAGTTAGGACGTTCTGTGGCAGCTCTTGGGGCTGGAACGGCT
GCCTACCATGCAGGAAAACAGGCTGGCTCAGACCAGAGAACTGCTTCCAGCTCCGGCTCTTCCAAACGGA
CGCAGGCAGACCACAGCAGACCAGACGGACAGGCAGCACCGGAAAAGGAATCCGTATGGAAACGGGCTGG
CTCTGCGGTAGGTACGGTGGCAGATACCAAAGATAAGATAAGTGATACTGCCGGACAGCTTCGGGAGCAG
GCAAAGGATTTGCCCGTCAATGCAAAGTACGCCCTTTACCACGGGAAAACACAGGTATCAGAGGGAGTAC
GGGATTTTACTTCCAGCGTGACCCAGACCCGAACTGCCAGAGCGGAACAACGAAATGCACAGGCAGAAAG
CCGCAGACAGACGATTGCAGAACGCAGGGCAGAACTGGAACAGGCAAAACAACCGCAACAGAGAGCTTCC
GAAACATCCAAAGGGGCGGCTCCTGTCCATGAACGCCCTGTTACTGCAAAGCAGCCAGAAAATTTCCGAC
ATCATGCAGATACCGCTCATACAGGAAAACCAGCCATGCAGCCAGTTTCCCCATCCATCAGGGAATGGGG
ACAGGTTTCTTATGAGGGGGCTGTGGCAGAACGGGCTTCGGTTCCGGTGGTAAAATCAGCTTCCATCCAC
CGTGAACAGACACCGCCTGTAAGGACAGAACGACAGATAGTCCCTCCGGCTTTCCCAGACAAACCAGAGG
AAAGACAAAAGACGGCTCCAACTGTCACACCGACTGCTCCCCGTCCGGCAAGACCTGTCCAGAACGACAC
GGCTCCTGTGATACTGGAAAGAAAACGGATTACCCCTGCGGTAAAAGAATCAAACTTTACCATCCGGCGT
ACCACCGCCAGAAAGGAGTGGACAAAAACGGTAACAGCGGCTGCCAAACAGAAGAAAGGGGAGAAACCAT
GA
 Primer design