SecReT4
Protein ID: 126700958
T4SS name [ID]Tra_Tn [669]
Gene symbol-
Locus tagCD630_33380
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]3901806..3904259 [-]
ProductATPase
Component typeOrf16_Tn
UniProt IDQ180I3
KEGG IDcdf:CD3338
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.5e-34, Aligned region: 468..763
Protein Sequence: 817 a.a.     [Download]
>gi|126700958|ref|YP_001089855.1| ATPase [Clostridium difficile 630]
MAYPIKYIENNLVFNHDGECFAYYELLPYNYSFLSPEQKYQVHDSFRQLIAQNRDGKIHALQISTESSIR
AAQERSKQEVTGKLKDVACAKIDAQTEALISMIGENQVDYRFFIGFKLLVNEQEVTMKQFRREAKTAVSD
FLHEVNHKLMGDFVSMSNEEIWRFQKMEKLLENKISRRFKVRRLDKDDFGYLIEHLYGQTGTAYEDYEYY
LPKKRFQEETLVKYYDLIKPTRCLIEENQRYLKIEQEDGTVYAAYFTINSIVGELDFPSSEIFYYQQQQF
TFPIDTSMNVEIVTNRKALSTVRNKKKELKDLDNHAWQNDSETSTNVVDALDSVNELESTLDQSKESMYK
LSYVVRVTAPDLEELKRRCNEVKDFYDDLNVKLVRPFGDMLGLHGEFLPASKRYLNDYIQYVTSDFLAGL
GFGATQMLGETEGIYIGYSLDTGRNVYLKPALASQGVKGSVTNALAAAFVGSLGGGKSFSNNMIVYYSVL
FGAQALIVDPKAERGRWKETLPEIAHEINIVNLTSEEQNRGLLDPYVIMENPKDSESLAIDILTFLTGIS
SRDGEKFPVLRKAIRAVTNSEERGLFKVIEELRAEGTAISTSIADHIESFTDYDFAHLLFSDGDVTQSIS
LEKQLNIIQVADLVLPDKETSFEEYTTMELLSVAMLIVISTFALDFIHTDRSVFKIVDLDEAWSFLQVAQ
GKTLSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKNNLGLKFAFRSTDINEIKKTLAFFGVDSEDENNQK
RLRDLENGQCLISDLYGRVGVIQFHPIFEDLFHAFDTRPPVRKEVEE
 
Nucleotide Sequence: 2454 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c3904259-3901806 Clostridium difficile 630, complete genome
ATGGCATATCCGATTAAATATATCGAAAATAACCTTGTGTTCAACCATGACGGGGAGTGCTTCGCTTACT
ATGAGCTGCTTCCCTACAACTATTCCTTTTTAAGCCCCGAACAGAAATATCAGGTACACGATTCCTTCCG
GCAGCTTATCGCCCAAAACAGGGACGGGAAGATTCACGCCCTGCAAATCAGCACCGAATCCAGCATACGG
GCGGCACAGGAACGCTCCAAACAGGAAGTGACAGGTAAGCTAAAGGATGTTGCCTGTGCAAAGATTGACG
CACAGACCGAAGCCCTGATTTCCATGATAGGGGAAAATCAGGTGGACTACCGCTTTTTTATCGGCTTTAA
GCTGCTTGTCAATGAGCAGGAAGTCACCATGAAACAGTTCCGCAGGGAAGCAAAGACCGCTGTTTCCGAC
TTCCTCCACGAAGTCAACCACAAGCTCATGGGGGATTTTGTTTCCATGAGCAATGAAGAAATCTGGCGGT
TTCAGAAGATGGAAAAACTGCTGGAAAATAAAATCTCACGCCGCTTCAAAGTCCGGCGGCTTGATAAAGA
CGATTTTGGCTACCTGATTGAGCATTTATACGGGCAGACCGGAACCGCCTACGAAGATTATGAGTATTAC
CTGCCGAAGAAGCGATTTCAAGAGGAAACGCTGGTGAAATACTATGACCTCATCAAACCCACCCGTTGTC
TGATAGAGGAAAACCAACGGTATCTGAAAATTGAACAGGAAGACGGAACAGTATATGCCGCCTACTTTAC
CATCAACAGCATTGTGGGGGAACTGGACTTCCCATCCTCGGAAATCTTTTACTATCAGCAGCAGCAATTC
ACCTTTCCCATTGATACCTCTATGAATGTGGAGATTGTGACAAACCGGAAAGCCCTCTCCACGGTGCGGA
ACAAGAAAAAAGAGCTGAAAGATTTGGACAACCACGCATGGCAGAATGACAGCGAAACCAGTACAAACGT
GGTGGATGCTTTAGACAGCGTGAATGAGCTGGAATCCACCTTAGACCAGAGCAAGGAATCCATGTATAAG
CTGTCCTATGTGGTTCGTGTGACGGCTCCCGACTTGGAAGAACTGAAACGCCGCTGCAATGAGGTGAAAG
ATTTTTATGACGATTTGAACGTGAAACTGGTTCGCCCCTTTGGGGATATGCTGGGGCTGCATGGGGAATT
TCTCCCTGCCAGCAAACGGTATCTGAACGATTACATCCAGTATGTCACCAGCGACTTCCTCGCTGGTCTT
GGCTTCGGGGCAACCCAGATGTTAGGAGAAACGGAGGGTATTTATATCGGGTACAGCCTTGATACAGGAA
GAAACGTGTACTTAAAGCCTGCCCTTGCCAGTCAGGGGGTAAAAGGCTCCGTCACCAACGCCCTTGCTGC
CGCTTTTGTCGGCTCCCTCGGCGGTGGAAAATCATTCAGTAACAACATGATTGTCTATTATTCCGTATTG
TTTGGGGCACAGGCACTCATTGTTGACCCGAAAGCGGAACGGGGACGCTGGAAAGAAACCCTGCCGGAAA
TCGCCCATGAAATCAATATCGTAAACCTGACTTCGGAGGAACAGAACAGGGGCTTACTTGACCCGTATGT
GATTATGGAGAACCCAAAAGATTCTGAATCACTGGCAATCGACATCCTGACCTTTTTAACCGGCATTTCC
AGCCGTGACGGGGAGAAATTCCCTGTTCTTCGGAAAGCCATCCGTGCGGTGACAAACAGTGAAGAACGGG
GGCTTTTCAAAGTGATTGAGGAACTACGGGCGGAGGGAACCGCCATCAGCACCAGCATAGCCGACCATAT
CGAATCCTTTACAGACTATGACTTTGCACACCTGCTCTTTTCGGATGGGGACGTCACACAGTCCATCAGC
CTTGAAAAGCAGCTCAACATCATTCAGGTGGCGGATTTGGTGCTGCCGGATAAGGAAACCTCGTTTGAAG
AATACACCACAATGGAGCTGCTTTCCGTGGCAATGCTCATTGTAATCAGTACCTTTGCCCTCGACTTCAT
CCACACTGACCGCAGCGTGTTTAAGATTGTGGATTTGGATGAAGCATGGAGCTTCTTACAGGTGGCACAG
GGCAAGACCCTCTCCATGAAGCTGGTTCGTGCCGGACGTGCTATGAACGCAGGCGTTTATTTTGTCACTC
AGAACACGGACGATTTGCTGGATGAAAAACTGAAAAACAATCTGGGCTTGAAGTTTGCGTTCCGTTCCAC
GGACATCAACGAAATCAAAAAGACCCTCGCCTTTTTCGGAGTGGATTCCGAAGATGAAAACAACCAGAAG
CGGCTCCGTGACTTGGAAAACGGACAGTGCCTCATCAGTGATTTGTACGGGCGTGTGGGCGTGATACAGT
TCCATCCTATCTTTGAAGACCTGTTCCATGCCTTTGATACCAGACCGCCCGTAAGAAAAGAGGTGGAGGA
ATGA
 Primer design