SecReT4
Protein ID: 126700959
T4SS name [ID]Tra_Tn [669]
Gene symbol-
Locus tagCD630_33390
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]3904243..3904635 [-]
Productconjugative transposon protein
Component typeOrf17_Tn
UniProt IDQ180I5
KEGG IDcdf:CD3339
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 9.6e-34, Aligned region: 6..107
Protein Sequence: 130 a.a.     [Download]
>gi|126700959|ref|YP_001089856.1| conjugative transposon protein [Clostridium difficile 630]
MKKIRSYTSIWSVEKVLYSINDFKLPFPITFTQMAWFVVSVFAVMLLGNLPPLSFIDGAFLKYFGVPFAL
TWFMCQKTFDGKKPYGFLKSVLAYLVRPKLTYAGKPVKLEKEYPAQPITAVRSDIYGISD
 
Nucleotide Sequence: 393 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c3904635-3904243 Clostridium difficile 630, complete genome
ATGAAGAAAATACGAAGCTATACCAGTATCTGGTCGGTGGAAAAGGTACTCTATTCCATCAATGATTTTA
AGCTGCCATTCCCCATCACATTCACACAGATGGCGTGGTTCGTGGTGTCGGTGTTTGCAGTTATGCTCTT
GGGGAACCTCCCTCCCCTTTCGTTCATTGACGGGGCATTTTTGAAATACTTCGGCGTACCCTTTGCCCTC
ACTTGGTTCATGTGCCAGAAGACCTTTGACGGGAAAAAGCCTTATGGCTTCCTGAAATCCGTACTGGCAT
ATCTGGTACGCCCGAAACTGACCTATGCAGGAAAGCCCGTGAAGCTGGAAAAGGAATATCCGGCACAGCC
CATCACGGCAGTAAGGAGTGATATTTATGGCATATCCGATTAA
 Primer design