SecReT4
Protein ID: 126700962
T4SS name [ID]Tra_Tn [669]
Gene symbol-
Locus tagCD630_33421
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]3906498..3906719 [-]
Productconjugative transposon protein
Component typeOrf19_Tn
UniProt IDQ180I6
KEGG IDcdf:CD3342A
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 73 a.a.     [Download]
>gi|126700962|ref|YP_001089859.1| conjugative transposon protein [Clostridium difficile 630]
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKREFSKLIGFLVVSLVAVGLVFNADGVKDILLELFNKI
IGA
 
Nucleotide Sequence: 222 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c3906719-3906498 Clostridium difficile 630, complete genome
ATGAATTTCGGACAGAATCTTTACAACTGGTTTTTATCCAACGCCCAGTCCCTTGTGCTGCTGGCAATCG
TGGTGATTGGACTGTACCTCGGATTTAAGAGGGAATTTTCCAAACTTATCGGTTTTCTGGTGGTGTCCCT
TGTAGCGGTCGGTCTGGTCTTCAATGCGGACGGTGTAAAGGACATCTTACTGGAACTGTTCAATAAGATT
ATCGGAGCATAG
 Primer design