SecReT4
Protein ID: 126700964
T4SS name [ID]Tra_Tn [669]
Gene symbol-
Locus tagCD630_33440
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]3908146..3909543 [-]
Productcell-division FtsK/SpoIIIE-family protein Tn916-like, CTn6-Orf22
Component typeOrf21_Tn
UniProt IDQ180I9
KEGG IDcdf:CD3344
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 1.3e-35, Aligned region: 192..370
AAA_10 [PF12846], Evalue: 1.3e-07, Aligned region: 227..264
DUF87 [PF01935], Evalue: 6.5e-07, Aligned region: 227..346
Protein Sequence: 465 a.a.     [Download]
>gi|126700964|ref|YP_001089861.1| cell-division FtsK/SpoIIIE-family protein Tn916-like, CTn6-Orf22 [Clostridium difficile 630]
MKQLFPRGKRIRPTDKDLMFHTALAALFPVFLLVVLLFHIRQIAGTNWQEVSLSQITQDVNIPYLLFSIG
MAGMVCLIAVLLFWRYRRDEVKQLIHRQKLARMVLENKWYESEQRKEDAFFKDLSSSRSKETITYFPKIY
YRMKQGLLHIRVEITLGKYQEQLLNLERKLESGLYCELTDKELKDSYVEYTLLYDTIANRISIEDVQAKD
GRLRLMENVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLRTNAVLFVLDPKNADLADLQAVMPDVYYK
KEDMLACIDRFYEEMMKRSEDMKLMENYRTGENYAYLGLPANFLIFDEYVAFMEMLGTKENAAVLNKLKQ
IVMLGRQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGETTKDFFLKQIKGRGYVDV
GTSVISEFYTPLVPKGHDFLKEIKKLTDSRQGVQAACEAEAAETD
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c3909543-3908146 Clostridium difficile 630, complete genome
ATGAAGCAGCTTTTCCCCCGTGGAAAACGTATCCGCCCCACGGATAAAGACCTTATGTTCCATACTGCCC
TTGCCGCCCTGTTCCCTGTCTTCCTGCTGGTTGTCCTGCTGTTTCATATCCGGCAAATTGCCGGAACCAA
CTGGCAGGAAGTGTCCCTCTCCCAGATAACACAGGATGTAAATATCCCTTATCTGCTATTCAGCATAGGT
ATGGCAGGAATGGTGTGTCTTATCGCAGTTCTTCTGTTCTGGCGATACCGCAGGGATGAAGTAAAGCAGC
TCATCCACCGCCAAAAGCTGGCAAGGATGGTATTGGAAAACAAGTGGTATGAATCGGAACAGAGAAAGGA
AGACGCTTTTTTCAAGGACTTGTCTTCCAGCCGTTCCAAAGAAACCATCACTTACTTTCCCAAAATCTAC
TACCGGATGAAACAGGGCTTGCTCCATATCCGTGTGGAAATCACCTTGGGGAAATATCAGGAACAGCTCT
TAAACTTGGAGAGAAAGCTGGAAAGCGGCTTGTACTGTGAGCTGACGGATAAGGAATTAAAGGATTCCTA
TGTGGAGTACACCCTGCTTTATGATACCATTGCCAACCGTATCTCCATTGAGGATGTACAAGCAAAAGAT
GGCAGGCTCCGACTCATGGAAAATGTCTGGTGGGAGTATGACAAGCTCCCCCATATGCTCATTGCCGGAG
GAACCGGCGGCGGAAAGACTTATTTCATCCTGACCCTTATTGAAGCCCTGCTCCGCACCAACGCCGTCCT
GTTCGTGTTAGACCCGAAGAACGCCGACCTTGCGGATTTACAGGCGGTTATGCCGGATGTGTACTACAAA
AAGGAAGATATGCTCGCCTGCATTGACCGTTTCTATGAAGAAATGATGAAACGCAGCGAAGACATGAAGC
TCATGGAGAATTACCGGACAGGGGAAAACTACGCTTACTTGGGACTTCCGGCAAATTTCCTTATCTTTGA
TGAATATGTGGCATTTATGGAAATGCTCGGCACAAAGGAAAACGCCGCTGTCCTCAACAAATTAAAACAA
ATCGTTATGCTTGGGCGGCAGGCTGGCTTCTTCCTGATTCTCGCCTGCCAGCGTCCAGATGCAAAGTATC
TGGGGGATGGAATCCGTGACCAGTTCAATTTCCGTGTAGCTCTGGGGCGGATGTCGGAAATGGGTTATGG
GATGATGTTCGGGGAAACCACAAAGGACTTCTTCCTAAAGCAGATAAAAGGGCGTGGCTATGTGGATGTG
GGAACCAGCGTTATCTCGGAATTTTACACGCCCCTTGTGCCAAAAGGACACGATTTTCTCAAAGAAATAA
AAAAGCTGACAGACAGCAGGCAGGGAGTGCAGGCGGCGTGCGAAGCGGAAGCCGCAGAAACGGACTGA
 Primer design