SecReT4
Protein ID: 126701003
T4SS name [ID]Tra_Tn [670]
Gene symbol-
Locus tagCD630_33800
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]3951764..3952771 [-]
Productcell wall hydrolase
Component typeOrf14_Tn
UniProt IDQ180M8
KEGG IDcdf:CD3380
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 6.5e-60, Aligned region: 47..204
NLPC_P60 [PF00877], Evalue: 2.9e-29, Aligned region: 226..331
SLT [PF01464], Evalue: 9.2e-06, Aligned region: 102..155
Protein Sequence: 335 a.a.     [Download]
>gi|126701003|ref|YP_001089900.1| cell wall hydrolase [Clostridium difficile 630]
MKLKHIALIGSLFPILFSLVLFFGVLISADSDDENSNFSSGITGMNLSAEVLKHQPMVEKYARENGISEY
VNVLLAIIQVESGGTAEDVMQSSESLGLPPNSLDMESSIKQGCKYFASLLSSCKNQGIDDLNVAIQSYNY
GGGYVGYVAGKGKKHTYNLAESFAREKSGGKKVTYTNPIAVVKNGGWRYQYGNQFYVELVNQYLTVPQVL
GELAQKVMNEALKYQGWKYVYGGSNPNTSFDCSGLTQWCYGKAGISLPRTAQMQYDATQHLPLSQAKAGD
LVFFHSTYNAGSYVTHVGIYVGNNQMYHAGDPIGYTDLSSSYWQQHLIGAGRVKQ
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c3952771-3951764 Clostridium difficile 630, complete genome
ATGAAACTGAAACATATCGCTCTCATTGGCAGTCTGTTTCCTATCCTCTTTTCTCTGGTGCTTTTCTTTG
GGGTGTTGATTAGTGCGGACAGCGACGACGAGAACAGCAACTTTTCTTCGGGTATTACGGGTATGAATTT
ATCCGCAGAAGTTTTGAAACATCAGCCTATGGTGGAAAAATACGCCAGAGAAAACGGTATCTCCGAGTAT
GTCAATGTGTTGCTGGCTATCATTCAAGTAGAAAGTGGCGGTACGGCAGAAGATGTCATGCAGTCCAGCG
AAAGTCTGGGACTACCGCCTAACTCTTTAGATATGGAAAGCTCAATCAAGCAGGGGTGTAAATATTTTGC
GTCCCTGCTTTCTTCCTGCAAAAATCAAGGTATCGACGATTTGAATGTAGCGATACAGTCCTATAACTAT
GGCGGTGGTTATGTGGGATATGTGGCAGGAAAAGGAAAGAAACATACATACAATCTTGCAGAGAGCTTCG
CCCGTGAGAAATCGGGTGGTAAGAAAGTAACCTACACCAACCCGATAGCTGTTGTGAAAAATGGTGGCTG
GCGTTACCAGTATGGCAATCAATTTTATGTGGAATTAGTCAATCAGTATTTAACTGTTCCGCAGGTATTG
GGAGAGCTGGCACAAAAGGTAATGAATGAAGCGTTGAAGTATCAAGGCTGGAAGTATGTATATGGCGGTA
GTAATCCGAACACTTCCTTTGACTGTTCGGGACTTACGCAATGGTGCTATGGAAAAGCTGGTATCTCTTT
ACCTAGAACAGCACAAATGCAATATGACGCTACCCAACATCTTCCACTCTCGCAGGCAAAGGCTGGCGAT
TTGGTATTTTTCCATTCCACCTATAACGCTGGTTCGTATGTAACCCACGTCGGTATCTATGTGGGAAATA
ATCAGATGTACCATGCAGGCGACCCGATAGGATATACAGACCTAAGTAGTAGTTACTGGCAACAGCACTT
AATCGGTGCAGGACGAGTAAAACAATAG
 Primer design