SecReT4
Protein ID: 126701011
T4SS name [ID]Tra_Tn [670]
Gene symbol-
Locus tagCD630_33890
StrainClostridium difficile 630
Repliconchromosome [GenBank: NC_009089] [Browse all T4SS(s) in this replicon]
Location [Strand]3961825..3963219 [-]
Productcell-division FtsK/SpoIIIE-family protein Tn916-like, CTn7-Orf28
Component typeOrf21_Tn
UniProt IDQ180N5
KEGG IDcdf:CD3389
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 3.1e-29, Aligned region: 191..368
AAA_10 [PF12846], Evalue: 1.7e-06, Aligned region: 225..262
Protein Sequence: 464 a.a.     [Download]
>gi|126701011|ref|YP_001089908.1| cell-division FtsK/SpoIIIE-family protein Tn916-like, CTn7-Orf28 [Clostridium difficile 630]
MERLKYKGKRIRASDKHLVYHFSIRTLLFVFVAVILLLNTKQLMRTDWEHFSLLENGLTLSPYNFITVLI
ATGVCALVAFLYYRLCYDSFKKLLHRQKLARMILENKWYEADTIQDDGFFTDLQSRSREKIVWFPKIYYQ
MEKGLLHIRCEITLGKYQDQLLRLEDKLESGLYCELTDKTLHDGYIEYTLLYDMIANRITIDEVRAENGC
LRLMKNLVWEYDALPHALIAGGTGGGKTYFLLTLIEALLHTNAVLYILDPKNADLADLGTVMGNVYHTKE
EMIDCVNSFYEGMVQRSEEMKRYPDYKTGENYAYLGLPPCFLIFDEYVAFFEMLGTKESVGLLSQLKKIV
MLGRQAGYFLIVACQRPDAKYFSDGIRDNFNFRVGLGRISELGYGMLFGSDVKKQFFQKRIKGRGYCDVG
TSVISEFYTPLVPKGHDFLQTIGSLAQARQDGTATCEAKGDGTD
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|126697566|ref|NC_009089.1|:c3963219-3961825 Clostridium difficile 630, complete genome
ATGGAACGATTAAAATATAAGGGAAAGCGTATCAGAGCCAGCGATAAGCACCTTGTCTATCACTTTTCCA
TAAGGACGCTTCTGTTTGTGTTCGTGGCGGTTATACTGCTATTAAATACAAAACAGCTCATGCGTACCGA
TTGGGAGCATTTCAGCTTGTTAGAAAACGGCTTGACGCTTTCCCCTTACAACTTCATAACCGTACTGATA
GCGACTGGTGTTTGTGCATTAGTCGCTTTTCTGTATTACCGTTTATGTTACGACAGTTTCAAGAAGCTCC
TGCACCGTCAAAAGCTGGCAAGAATGATACTGGAAAATAAGTGGTATGAAGCTGATACCATACAAGACGA
CGGTTTTTTTACTGACCTGCAAAGCAGATCAAGGGAAAAAATCGTCTGGTTTCCAAAGATTTATTATCAA
ATGGAAAAAGGCTTGCTTCATATCCGCTGTGAAATCACGCTGGGGAAATATCAAGACCAGCTCTTACGGT
TAGAGGATAAACTGGAAAGTGGTTTGTATTGTGAGCTGACCGACAAGACCTTACATGACGGCTATATTGA
ATATACCCTGCTTTATGACATGATAGCAAACCGTATTACCATTGATGAAGTACGGGCAGAAAACGGCTGT
CTTAGGCTGATGAAAAATCTTGTCTGGGAATATGACGCACTCCCTCACGCCCTTATCGCTGGTGGGACTG
GTGGCGGTAAGACTTACTTTCTGCTGACGCTCATTGAAGCCCTACTGCACACCAACGCTGTCCTTTACAT
CTTAGACCCGAAGAACGCTGACCTTGCGGACTTGGGGACAGTCATGGGAAATGTGTATCACACCAAAGAA
GAAATGATAGACTGCGTCAATTCCTTTTATGAGGGAATGGTACAGCGAAGCGAGGAAATGAAGCGATACC
CAGACTATAAGACGGGCGAAAACTACGCCTATCTGGGACTGCCCCCCTGCTTTCTTATCTTTGATGAATA
TGTGGCGTTTTTTGAAATGCTGGGGACAAAAGAAAGTGTGGGCTTACTTAGCCAGTTAAAGAAAATCGTC
ATGTTAGGACGACAAGCAGGTTATTTCCTTATCGTTGCCTGCCAGCGACCAGACGCAAAATATTTCTCGG
ACGGTATCAGAGATAACTTCAATTTCCGTGTGGGATTGGGGCGTATCAGCGAGTTAGGATATGGTATGCT
GTTTGGTTCAGATGTGAAAAAGCAGTTTTTCCAGAAGCGTATCAAAGGGCGTGGATATTGTGATGTGGGA
ACAAGCGTCATAAGTGAATTTTACACGCCTTTAGTCCCGAAAGGACATGATTTTTTGCAGACAATCGGTT
CTCTTGCACAAGCAAGGCAGGACGGGACGGCAACGTGCGAAGCGAAAGGCGACGGCACGGACTAG
 Primer design