SecReT4
Protein ID: 133756215
T4SS name [ID]Trw [156]
Gene symbol-
Locus tagD616_p80039
StrainEscherichia coli plasmid pLEW517 (NC_009132)
Repliconplasmid pLEW517 [GenBank: NC_009132] [Browse all T4SS(s) in this replicon]
Location [Strand]33630..34514 [-]
Producthypothetical protein
Component typeTrwF
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.7e-57, Aligned region: 33..267
Protein Sequence: 294 a.a.     [Download]
>gi|133756215|ref|YP_001096365.1| hypothetical protein [Escherichia coli]
MKKLLLSAVVLSVLGGAATNVMALEVGRNSPYDYRIKSVVYNPVNVVKIDAVAGVATHIVVAPDETYITH
AFGDSESWTFAHKMNHFFVKPKQAMSDTNLVIVTDKRTYNIVLHFIGEETKKNADGTVSKSFIETPWAVR
HAVLQLTYEYPFEQQEKAKSAADKKRITQKLKQTAFAGAKNYQYVMSEQPEMRSIQPVHVWDNYRFTRFE
FPANAELPQVYMISASGKETLPNSHVVGENRNIIEVETVAKEWRIRLGDKVVGVRNNNFAPGAGAVATGT
ASPDVRRVQIGEDN
 
Nucleotide Sequence: 885 bp     [Download]
>gi|133756175|ref|NC_009132.1|:c34514-33630 Escherichia coli plasmid pLEW517, complete sequence
ATGAAAAAACTACTTCTTTCAGCAGTCGTTTTGTCAGTCCTGGGAGGCGCGGCCACTAACGTTATGGCGC
TTGAGGTTGGCCGCAATTCTCCTTATGACTATCGCATTAAAAGCGTTGTTTATAACCCTGTTAATGTGGT
CAAAATTGACGCTGTCGCCGGTGTGGCTACCCACATTGTTGTCGCGCCTGACGAAACCTATATCACTCAT
GCTTTTGGCGATTCTGAAAGCTGGACGTTTGCGCACAAAATGAACCATTTTTTTGTGAAGCCGAAACAGG
CCATGAGTGATACCAACCTGGTGATCGTCACCGATAAGCGCACCTATAACATCGTCCTCCATTTCATCGG
TGAAGAAACGAAGAAAAATGCAGACGGTACGGTATCAAAATCCTTTATTGAAACGCCGTGGGCTGTGCGC
CATGCCGTTCTTCAGCTGACCTATGAATATCCGTTTGAGCAGCAGGAAAAAGCCAAAAGCGCGGCTGATA
AAAAACGCATTACGCAGAAGCTGAAGCAGACGGCTTTTGCGGGGGCGAAGAACTATCAGTACGTAATGAG
CGAACAGCCTGAAATGCGCAGCATCCAGCCGGTTCACGTCTGGGATAACTACCGCTTTACCCGGTTTGAG
TTTCCGGCCAATGCGGAGTTACCGCAGGTCTACATGATCTCGGCCAGTGGCAAAGAAACGCTGCCTAACT
CTCATGTTGTGGGTGAGAACCGCAACATCATCGAGGTGGAAACCGTCGCTAAAGAGTGGCGTATTCGTCT
GGGCGATAAAGTCGTTGGCGTTCGTAATAATAATTTCGCGCCGGGCGCCGGTGCGGTAGCAACCGGTACG
GCTTCCCCGGATGTGCGCAGGGTTCAAATTGGGGAGGATAACTGA
 Primer design