SecReT4
Protein ID: 133756216
T4SS name [ID]Trw [156]
Gene symbol-
Locus tagD616_p80040
StrainEscherichia coli plasmid pLEW517 (NC_009132)
Repliconplasmid pLEW517 [GenBank: NC_009132] [Browse all T4SS(s) in this replicon]
Location [Strand]34525..35223 [-]
Producthypothetical protein
Component typeTrwG
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9e-53, Aligned region: 24..230
Protein Sequence: 232 a.a.     [Download]
>gi|133756216|ref|YP_001096366.1| hypothetical protein [Escherichia coli]
MKANKKTGLTREAIKEFNESRKGLEVDLMDEVLKSRRTAWMVATGSAVVTVFALSLVGYVVHKYSQPIPA
HLLTLNEATHEVQQVKLTRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVGLMSTPNVAESYQSK
FKGRNGLDKVLGDSETTRVKINSVILDKPHGVATIRFTTVRRVRSNPVDDQPQRWIAIMGYEYKSLAMNA
EQRYVNPLGFRVTSYRVNPEVN
 
Nucleotide Sequence: 699 bp     [Download]
>gi|133756175|ref|NC_009132.1|:c35223-34525 Escherichia coli plasmid pLEW517, complete sequence
ATGAAAGCTAATAAAAAAACAGGGCTTACACGTGAAGCCATTAAAGAGTTCAACGAAAGCCGTAAAGGGC
TTGAAGTTGATCTGATGGATGAAGTGCTGAAGTCCCGGCGTACCGCCTGGATGGTTGCCACCGGTTCAGC
GGTGGTAACTGTTTTTGCACTCTCTTTAGTTGGTTACGTAGTGCATAAGTACAGCCAGCCAATCCCCGCA
CATCTGCTAACGCTCAACGAGGCCACTCACGAAGTACAGCAGGTCAAGCTGACCCGCGACCAGACCTCTT
ATGGTGACGAAATTGATAAGTTCTGGCTGACACAATATGTCATTCACCGTGAGAGCTATGACTTCTATTC
AGTTCAGGTCGACTATACGGCCGTTGGCTTAATGTCCACGCCGAACGTGGCAGAGTCTTACCAGAGCAAG
TTCAAGGGCCGCAATGGTCTTGATAAGGTTCTGGGCGACAGTGAAACGACCCGCGTGAAGATTAACTCTG
TGATCCTCGATAAACCGCACGGCGTAGCAACAATACGCTTTACTACGGTTCGCCGCGTGCGCAGCAATCC
CGTTGATGATCAGCCGCAGCGCTGGATTGCCATTATGGGGTATGAATATAAATCGCTGGCGATGAATGCT
GAGCAGCGTTATGTCAACCCGCTGGGTTTCCGCGTGACGAGTTATCGCGTCAACCCGGAAGTTAACTGA
 Primer design