SecReT4
Protein ID: 133756219
T4SS name [ID]Trw [156]
Gene symbol-
Locus tagD616_p80043
StrainEscherichia coli plasmid pLEW517 (NC_009132)
Repliconplasmid pLEW517 [GenBank: NC_009132] [Browse all T4SS(s) in this replicon]
Location [Strand]36733..37446 [-]
Producthypothetical protein
Component typeTrwJ
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 5.9e-49, Aligned region: 25..216
Protein Sequence: 237 a.a.     [Download]
>gi|133756219|ref|YP_001096369.1| hypothetical protein [Escherichia coli]
MKKSLTAVLLTTGLILGGAQSASAGIIVSNPTELIKQGEQLEQMAQQLEQLKSQLETQKNMYESMAKTTN
LGDLLGTSTNTLANNLPDNWKEVYSDAMNSSSSVTPSVNSMMGQFNAEVDDMTPSEAIAYMNKKLAEKGA
YDRVMAEKAYNNQMQELSDMQALTEQIKSTPDLKSIADLQARIQTSQGAIQGEQAKLNLMNMLQQSQDKL
LRAQKDRATRNFVFGTGGDVTASPSIN
 
Nucleotide Sequence: 714 bp     [Download]
>gi|133756175|ref|NC_009132.1|:c37446-36733 Escherichia coli plasmid pLEW517, complete sequence
ATGAAAAAATCACTTACGGCAGTGCTGCTGACCACCGGCTTGATTCTTGGGGGCGCGCAAAGCGCCTCCG
CTGGCATCATCGTATCCAACCCCACCGAGCTGATTAAACAGGGTGAACAGCTTGAACAAATGGCTCAACA
GCTGGAGCAGCTTAAAAGCCAGCTGGAGACGCAGAAAAATATGTATGAGTCGATGGCTAAAACAACCAAC
CTGGGCGATCTGCTGGGGACGTCAACCAATACGCTGGCGAATAACCTGCCTGACAACTGGAAAGAGGTGT
ACAGCGACGCGATGAACTCCAGTTCGTCGGTCACGCCTTCTGTTAACAGCATGATGGGCCAGTTTAATGC
TGAGGTTGACGACATGACGCCCAGCGAAGCAATCGCCTATATGAACAAAAAGCTGGCGGAAAAAGGTGCT
TACGACCGTGTGATGGCCGAAAAAGCCTACAACAACCAGATGCAAGAGCTGAGCGATATGCAGGCGCTGA
CGGAGCAGATTAAATCGACGCCAGACCTGAAATCCATTGCCGACCTGCAAGCACGTATCCAGACGTCACA
AGGCGCTATACAGGGTGAGCAGGCGAAGCTGAATTTGATGAATATGTTACAGCAATCGCAGGACAAACTT
TTGCGCGCACAGAAGGATCGTGCGACCCGTAATTTTGTTTTTGGAACCGGTGGGGACGTTACCGCGTCAC
CTTCAATTAACTGA
 Primer design