SecReT4
Protein ID: 133756222
T4SS name [ID]Trw [156]
Gene symbol-
Locus tagD616_p80046
StrainEscherichia coli plasmid pLEW517 (NC_009132)
Repliconplasmid pLEW517 [GenBank: NC_009132] [Browse all T4SS(s) in this replicon]
Location [Strand]40431..40724 [-]
Producthypothetical protein
Component typeTrwL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-06, Aligned region: 11..91
Protein Sequence: 97 a.a.     [Download]
>gi|133756222|ref|YP_001096372.1| hypothetical protein [Escherichia coli]
MTTLFKKYGPAVVMGVLSIALPQIALAAGTDTGESTATSIQTWLSTWIPIGCAIAIMVSCFMWMLHVIPA
SFIPRIVISLIGIGSASYLVSLTGVGS
 
Nucleotide Sequence: 294 bp     [Download]
>gi|133756175|ref|NC_009132.1|:c40724-40431 Escherichia coli plasmid pLEW517, complete sequence
ATGACCACGTTGTTTAAGAAGTATGGCCCTGCGGTAGTTATGGGCGTTTTGTCCATTGCCCTGCCGCAAA
TTGCGCTGGCCGCTGGCACCGATACTGGTGAATCAACCGCTACATCAATCCAGACGTGGTTGAGCACATG
GATTCCAATTGGTTGTGCTATTGCGATCATGGTTAGTTGCTTTATGTGGATGCTTCACGTAATCCCAGCC
AGCTTTATTCCTCGTATCGTAATCTCTCTGATTGGTATTGGTTCTGCATCATATCTGGTTTCCCTGACGG
GCGTAGGAAGCTGA
 Primer design