SecReT4
Protein ID: 133756508
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81069
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]49964..50473 [-]
Productlytic transglycosylase
Component typeOrf169_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 169 a.a.     [Download]
>gi|133756508|ref|YP_001096464.1| lytic transglycosylase [Escherichia coli]
MKKWMLAICLMFINGICEAADCFDLAGRDYKIDPDLLRAISWKESRYRVNAIGINPVTGYGSGLMQVDSQ
HFNELARYGIKPEHLTTDPCMNIYTGAYYLAIAFKKWGVSWEAVGAYNAGFRKTERQNQRRLAYASEVYR
IYTWIKSSKGIRVPTTKKSLSQINSVQKN
 
Nucleotide Sequence: 510 bp     [Download]
>gi|133756440|ref|NC_009133.1|:c50473-49964 Escherichia coli plasmid NR1, complete sequence
ATGAAAAAATGGATGTTAGCAATCTGCCTGATGTTTATAAATGGGATCTGCGAAGCCGCCGATTGCTTTG
ATCTTGCAGGTCGGGATTACAAAATAGACCCGGATTTACTGAGAGCGATATCATGGAAAGAATCCCGTTA
CCGGGTTAATGCCATCGGTATTAATCCGGTAACGGGATATGGCAGCGGACTGATGCAGGTAGATTCCCAG
CATTTTAACGAACTGGCCCGCTATGGAATTAAGCCGGAACATCTGACAACAGATCCCTGTATGAACATTT
ATACCGGTGCTTATTATCTGGCAATAGCCTTTAAAAAATGGGGCGTCTCCTGGGAGGCCGTTGGTGCATA
CAATGCCGGATTCAGGAAGACCGAACGCCAGAACCAGAGACGTCTTGCCTACGCATCAGAGGTTTACCGG
ATTTATACCTGGATAAAGAGCAGTAAAGGCATCCGGGTTCCGACCACGAAGAAATCACTTTCCCAAATTA
ACAGTGTGCAGAAAAATTAA
 Primer design