SecReT4
Protein ID: 133756509
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81068
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]50889..51272 [+]
Productconjugal transfer protein M
Component typeTraM_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 3.6e-58, Aligned region: 1..127
Protein Sequence: 127 a.a.     [Download]
>gi|133756509|ref|YP_001096465.1| conjugal transfer protein M [Escherichia coli]
MARVILYISNDVYDKVNAIVEQRRQEGARDKDISVSGTASMLLELGLRVYEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDEE
 
Nucleotide Sequence: 384 bp     [Download]
>gi|133756440|ref|NC_009133.1|:50889-51272 Escherichia coli plasmid NR1, complete sequence
ATGGCCAGAGTAATTTTGTATATCAGTAATGATGTCTATGATAAAGTAAATGCGATAGTTGAACAGCGTC
GTCAGGAGGGGGCAAGAGATAAAGATATAAGTGTTTCGGGAACAGCTTCAATGCTTCTTGAACTGGGGCT
TCGTGTATATGAGGCTCAGATGGAGCGTAAAGAGTCTGCGTTTAATCAGACAGAGTTTAATAAACTTCTT
CTTGAATGTGTTGTAAAAACACAGTCATCAGTAGCGAAAATTTTGGGTATTGAGTCTCTAAGTCCCCATG
TCTCCGGGAATCCAAAGTTTGAATATGCCAATATGGTTGAAGATATTCGTGAGAAGGTGTCATCTGAGAT
GGAACGATTTTTTCCAAAAAATGATGAGGAATAA
 Primer design