SecReT4
Protein ID: 133756511
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81071
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]52274..52501 [+]
Productconjugal transfer protein Y
Component typeTraY_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 2.4e-21, Aligned region: 14..59
Protein Sequence: 75 a.a.     [Download]
>gi|133756511|ref|YP_001096467.1| conjugal transfer protein Y [Escherichia coli]
MSRNIIRPAPGNKVLLVLDDATNHKLLGARERSGRTKTNEVLVRLRDHLNRFPDFYNLDAIKEGAEETDS
IIKDL
 
Nucleotide Sequence: 228 bp     [Download]
>gi|133756440|ref|NC_009133.1|:52274-52501 Escherichia coli plasmid NR1, complete sequence
TTGAGCAGAAATATAATAAGGCCTGCTCCGGGCAATAAAGTTTTACTGGTATTGGACGATGCTACTAATC
ACAAGCTCTTAGGTGCCCGGGAACGTAGTGGGAGAACAAAAACTAATGAGGTGCTAGTCAGGTTACGTGA
TCATCTGAACCGTTTTCCTGACTTTTATAATCTGGATGCAATAAAGGAGGGAGCAGAGGAAACTGATTCG
ATAATTAAAGATCTTTAG
 Primer design