SecReT4
Protein ID: 133756512
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81072
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]52534..52893 [+]
Productprepropilin
Component typeTraA_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 4.4e-55, Aligned region: 1..118
Protein Sequence: 119 a.a.     [Download]
>gi|133756512|ref|YP_001096468.1| prepropilin [Escherichia coli]
MNTVLSVQGASAPVEKKSFFSKFTRLNMLRLVRAVIPVAVLMMLFPELAMAAGKGDLMAKGNDTVKATFG
KDSSIVKWVVLAEVLVGAVMYMMTKNVKFLVGFAIISVFIAVGMSVVGL
 
Nucleotide Sequence: 360 bp     [Download]
>gi|133756440|ref|NC_009133.1|:52534-52893 Escherichia coli plasmid NR1, complete sequence
ATGAATACTGTTTTAAGTGTTCAGGGTGCTTCTGCGCCCGTTGAAAAGAAATCGTTTTTTTCTAAATTCA
CTCGTCTGAATATGCTTCGCCTGGTTCGTGCAGTGATCCCGGTTGCTGTTCTGATGATGTTGTTCCCTGA
GTTAGCTATGGCTGCTGGTAAAGGCGACCTGATGGCTAAAGGTAACGATACGGTTAAGGCGACCTTCGGT
AAGGACTCCAGTATCGTTAAATGGGTTGTTCTGGCTGAGGTGCTGGTCGGTGCGGTCATGTACATGATGA
CCAAAAACGTCAAGTTCCTGGTCGGCTTTGCCATCATCTCTGTATTTATTGCTGTGGGTATGAGCGTCGT
TGGCCTCTGA
 Primer design