SecReT4
Protein ID: 133756513
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81073
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]52908..53219 [+]
Productconjugal transfer protein L
Component typeTraL_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 5.8e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|133756513|ref|YP_001096469.1| conjugal transfer protein L [Escherichia coli]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICVGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|133756440|ref|NC_009133.1|:52908-53219 Escherichia coli plasmid NR1, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTGTTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design