SecReT4
Protein ID: 133756514
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81075
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]53241..53807 [+]
Productconjugal transfer protein E
Component typeTraE_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.4e-69, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|133756514|ref|YP_001096470.1| conjugal transfer protein E [Escherichia coli]
MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNLIQGVNNYRLQNEQRTAVTPMGFNVPFAVSQNSADASYL
QQMALSFIALRLNVSPEIVDASHQALLQYIRPGAQNQMKVILAEEAKLIKKDNVNSAFFQTSVRVWPQYG
RVEIRGIRKTWIGNSEPFTDIKHYILILKRENGVTWLDNFGETDDEKK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|133756440|ref|NC_009133.1|:53241-53807 Escherichia coli plasmid NR1, complete sequence
ATGGAACACGGTGCCCGTTTAAGTACCAGTCGTGTAATGGCCATCGCCTTTATATTTATGTCAGTGCTTA
TTGTTCTCAGCCTCTCTGTTAACCTCATTCAGGGGGTGAATAACTACCGTCTTCAGAATGAGCAACGCAC
TGCCGTGACCCCAATGGGATTTAATGTGCCCTTTGCCGTGTCACAGAACAGTGCCGATGCCTCTTATTTG
CAGCAGATGGCGCTGTCATTTATTGCCCTCCGTCTGAATGTCTCACCGGAAATCGTCGATGCTTCACATC
AGGCGCTTCTGCAATATATCCGCCCGGGTGCACAGAACCAGATGAAAGTTATTCTGGCTGAAGAAGCGAA
ACTCATTAAAAAAGATAACGTGAATTCTGCTTTTTTCCAGACCAGTGTCCGTGTCTGGCCTCAGTATGGT
CGTGTGGAAATCCGTGGAATTCGGAAAACATGGATTGGTAACTCCGAACCTTTTACTGATATCAAACATT
ACATCCTTATTCTGAAGCGGGAAAACGGGGTGACCTGGCTGGATAATTTCGGGGAAACAGACGATGAGAA
AAAATAA
 Primer design