SecReT4
Protein ID: 133756515
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81074
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]53794..54522 [+]
Productconjugal transfer protein K
Component typeTraK_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 5.7e-69, Aligned region: 13..235
Protein Sequence: 242 a.a.     [Download]
>gi|133756515|ref|YP_001096471.1| conjugal transfer protein K [Escherichia coli]
MRKNNTAIIFGGLFFSCSVMAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNSLDGALTN
NEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDLRGTGEEAGAWETSTPYESL
LVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADSVWTGNHLKMVRFVVENKTLSALNIRESDFWQ
PGTRAVMFSQPASQLLAGARMDVYVIRDGEGN
 
Nucleotide Sequence: 729 bp     [Download]
>gi|133756440|ref|NC_009133.1|:53794-54522 Escherichia coli plasmid NR1, complete sequence
ATGAGAAAAAATAATACGGCAATAATATTCGGCGGCCTGTTTTTTTCCTGCAGCGTGATGGCCGCAAACG
GTACGCTGGCCCCCACTGTGGTGCCAATGGTGAACGGTGGTCAGGCCAGTATTGCCATCAGCAATACCAG
CCCGAATCTGTTTACCGTTCCCGGTGACCGGATTATCGCCGTGAACAGTCTGGATGGTGCCCTGACCAAT
AATGAGCAGACCGCCTCCGGCGGTGTGGTGGTGGCCACCGTCAACAAAAAGCCCTTTACGTTCATTCTGG
AAACAGAGCGTGGTCTGAACCTTTCCATTCAGGCTGTTCCCCGTGAAGGCGCGGGGCGTACCATTCAGCT
GGTCAGTGACCTGCGCGGAACCGGAGAAGAAGCCGGAGCGTGGGAAACGTCCACGCCTTACGAATCCCTG
CTTGTGACCATCAGCCAGGCTGTCCGTGGCGGAAAATTACCTGCAGGCTGGTATCAGGTTCCTGTGACAA
AGGAAACCCTGCAGGCCCCGGCGGGGCTGTCTTCAGTGGCAGATTCCGTATGGACGGGGAATCACCTGAA
GATGGTCCGCTTTGTCGTGGAAAATAAAACGCTGTCTGCCCTGAATATCCGGGAAAGTGATTTCTGGCAG
CCGGGAACCCGTGCCGTGATGTTCAGCCAGCCTGCCAGCCAGTTACTGGCAGGTGCGCGCATGGATGTGT
ATGTCATCCGTGACGGGGAGGGCAACTGA
 Primer design