SecReT4
Protein ID: 133756516
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81076
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]54522..55973 [+]
Productconjugal transfer protein B
Component typeTraB_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.1e-40, Aligned region: 213..409
CALCOCO1 [PF07888], Evalue: 4.8e-05, Aligned region: 68..121
Protein Sequence: 483 a.a.     [Download]
>gi|133756516|ref|YP_001096472.1| conjugal transfer protein B [Escherichia coli]
MASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGETVAEQEPVPDMTGVVDTTFDDKVRQHA
TTEMQVTAAQMQKQYEEIRRELDVLNKQRGDDQRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQMPA
PPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGPS
LPYIPSGSFAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAI
VRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLG
ATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALEQS
QSTAEEGNPESPVPNPPSAESHLNGFNTDQMLKQLGNLNPQQFMSGDKNPLGGDAGKEGGNGG
 
Nucleotide Sequence: 1452 bp     [Download]
>gi|133756440|ref|NC_009133.1|:54522-55973 Escherichia coli plasmid NR1, complete sequence
ATGGCCAGTATCAATACCATTGTGAAACGCAAGCAGTACCTGTGGCTGGGGATTGTGGTTGTCGGTACAG
CCTCCGCGATTGGTGGGGCACTGTATCTGTCTGATGTGGACATGTCCGGTAACGGTGAAACCGTGGCTGA
ACAGGAGCCTGTGCCGGATATGACCGGTGTGGTGGATACGACCTTTGATGACAAGGTGCGTCAGCATGCC
ACCACAGAGATGCAGGTGACGGCAGCGCAGATGCAGAAGCAGTATGAGGAAATCCGTCGTGAGCTGGATG
TTCTGAACAAACAGCGCGGTGATGACCAGCGTCGTATTGAAAAGCTGGGACAGGACAATGCCGCCCTGGC
AGAGCAGGTAAAAGCCCTGGGTGCTAATCCCGTCACGGCGACCGGTGAGCCTGTACCGCAGATGCCTGCC
CCACCGCCCGGCCCGGAAGGCGAACCACAGCCAGGAAACACCCCCGTATCCTTCCCGCCGCAGGGCAGCG
TTGCTGTTCCACCGCCGACGGCGTTTTATCCCGGGAATGGTGTCACGCCACCACCACAGGTGACGTACCA
GTCTGTGCCGGTGCCTAACCGGATACAGCGTAAGGTGTTTACCCGTAATGAGGGAAAACAGGGACCATCG
CTGCCGTACATTCCGTCAGGAAGTTTTGCGAAAGCCATGCTGATTGAAGGGGCGGATGCCAATGCCTCAG
TCACCGGTAATGAATCCACGGTGCCGATGCAGTTGCGTATCACCGGCCTGGTGGAAATGCCGAACAGCAA
GACGTATGACGCAACGGGATGTTTTGTGGGGCTGGAAGCCTGGGGGGATGTGTCCAGTGAACGTGCCATT
GTACGCACCCGCAATATCAGTTGCCTGAAGGACGGCAAAACTATTGATATGCCGATTAAGGGGCATGTCA
GCTTCCGGGGTAAAAACGGTATCAAGGGCGAAGTGGTGATGCGTAACGGCAAAATCCTCGGCTGGGCATG
GGGCGCGGGATTTGTTGACGGTATCGGTCAGGGAATGGAGCGCGCCTCCCAACCGGCTGTCGGGCTGGGT
GCCACAGCCGCTTACGGGGCTGGTGATGTCCTGAAAATGGGTATCGGTGGCGGCGCATCGAAAGCCGCAC
AGACGCTCAGTGACTACTACATCAAACGTGCCGAACAGTATCACCCGGTGATACCGATTGGTGCGGGCAA
CGAAGTGACCGTGGTGTTCCAGGACGGCTTCCAGCTGAAAACCGTGGAGGAAATGGCACTGGAGCAGTCA
CAGAGTACAGCGGAAGAGGGTAACCCGGAAAGCCCGGTGCCGAATCCTCCCTCGGCAGAAAGCCACCTGA
ACGGTTTTAACACCGACCAGATGCTGAAACAGCTGGGCAATCTGAATCCGCAGCAGTTTATGTCCGGAGA
CAAGAACCCGCTGGGCGGGGATGCCGGCAAGGAGGGCGGAAATGGCGGGTGA
 Primer design