SecReT4
Protein ID: 133756519
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81079
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]56833..57348 [+]
Productconjugal transfer protein
Component typeTraV_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 4.1e-40, Aligned region: 23..165
Protein Sequence: 171 a.a.     [Download]
>gi|133756519|ref|YP_001096475.1| conjugal transfer protein [Escherichia coli]
MKQISLFIPLLGTLLLSGCAGTNTEFECNATTSDTCMTMEQANEKAKKLEQSSEAKPVAASLPRLAEGNF
RTMPVQTVTATTPSGSRPAVTAHPEQKLLAPRPLFTAAREVKTVVPVSSVTPVTPPRPLRTGEQTAALWI
APYIDNQDVYHQPSSVFFVIKPSAWGKPRIN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|133756440|ref|NC_009133.1|:56833-57348 Escherichia coli plasmid NR1, complete sequence
ATGAAACAGATTTCTTTATTTATTCCTCTGCTGGGAACCTTATTACTTTCCGGCTGCGCAGGAACAAATA
CGGAATTTGAGTGTAACGCCACCACATCCGATACCTGTATGACGATGGAGCAGGCCAATGAGAAGGCCAA
AAAACTGGAGCAGTCCTCAGAAGCAAAGCCGGTTGCGGCATCACTGCCGCGCCTGGCTGAAGGGAACTTC
CGGACAATGCCGGTGCAGACCGTCACCGCGACCACTCCGTCCGGCAGCAGACCTGCGGTGACAGCACATC
CGGAGCAGAAACTGCTGGCACCACGCCCGCTGTTTACCGCTGCCCGGGAAGTGAAAACGGTTGTTCCGGT
CAGTTCAGTTACGCCGGTAACACCTCCTCGTCCGCTAAGAACGGGTGAGCAGACGGCAGCATTATGGATA
GCGCCTTATATTGATAACCAGGATGTTTATCATCAGCCATCCAGCGTGTTTTTTGTTATTAAACCGTCTG
CGTGGGGAAAACCACGTATTAATTAA
 Primer design