SecReT4
Protein ID: 133756525
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81085
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]59375..62005 [+]
Productconjugal transfer protein C
Component typeTraC_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.2e-58, Aligned region: 38..278
AAA_10 [PF12846], Evalue: 4.1e-43, Aligned region: 480..773
DUF87 [PF01935], Evalue: 3.2e-05, Aligned region: 483..670
TrwB_AAD_bind [PF10412], Evalue: 7.4e-05, Aligned region: 480..518
Protein Sequence: 876 a.a.     [Download]
>gi|133756525|ref|YP_001096481.1| conjugal transfer protein C [Escherichia coli]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANKSIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLNVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNRKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
 
Nucleotide Sequence: 2631 bp     [Download]
>gi|133756440|ref|NC_009133.1|:59375-62005 Escherichia coli plasmid NR1, complete sequence
ATGAGTAATAACCCACTTGAGGCCGTCACTCAGGCGGTTAACTCCCTCGTCACAGCACTGAAACTGCCTG
ACGAATCCGCAAAGGCCAATGAAGTTCTGGGCGAAATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCCGTA
CCGTGATTACAACCAGGAATCCGGTCTGTTCATGAATGACACCACGATGGGCTTTATGCTGGAAGCCATT
CCCATCAATGGGGCGAATAAGTCCATTGTGGAGGCACTCGATCACATGCTGCGCACCAAACTGCCGCGCG
GTATTCCGTTGTGTATCCATCTGATGTCCAGTCAGCTGGTTGGTGACAGGATTGAGTACGGGCTGCGTGA
GTTCTCCTGGTCAGGTGAACAGGCTGAACGGTTTAACGCCATTACCCGGGCCTATTATATGAAAGCGGCA
GCGACACAGTTTCCGCTGCCGGAGGGGATGAATCTGCCCCTGACCCTGCGCCATTACCGGGTATTTATCT
CGTACTGTTCTCCCTCGAAGAAAAAAAGCCGGGCTGACATTCTGGAAATGGAAAACCTGGTGAAAATCAT
CCGGGCGTCGTTACAGGGGGCCAGTATCGCCACACAGACGGTGGATGCACAGGCCTTTATCGATATTGTC
GGGGAGATGATTAACCATAACCCGGACTCCCTGTACCCGAAAAGACGTCAGCTGGACCCGTATTCTGATC
TGAATTATCAGTGTGTGGAGGACAGTTTTGACCTGAATGTCCGGGCTGATTACCTGACGCTGGGCCTGCG
TGAGAACGGCAGGAACAGCACGGCCCGTATCCTGAATTTCCATCTGGCCCGTAACCCGGAAATCGCCTTC
CTGTGGAATATGGCCGACAACTACAGCAACCTGCTGAACCCGGAACTGTCCATCTCCTGTCCGTTCATCC
TGACGCTGACTCTGGTGGTGGAAGACCAGGTGAAAACCCACAGCGAAGCCAACCTGAAGTACATGGACCT
GGAGAAAAAGTCGAAGACCTCCTATGCCAAATGGTTTCCGTCCGTGGAGAAAGAGGCGAAGGAGTGGGGG
GAACTGCGTCAGCGTCTGGGCTCCGGTCAGTCTTCTGTCGTGTCCTACTTCCTCAACATCACAGCATTCT
GCAAGGACAACAATGAAACGGCGCTGGAAGTGGAGCAGGACATCCTGAACAGCTTCCGTAAAAACGGTTT
TGAGCTGATTTCACCGCGCTTTAACCACATGCGCAATTTCCTGACCTGTCTGCCCTTTATGGCCGGGAAA
GGGTTGTTTAAACAGCTGAAAGAGGCCGGAGTGGTTCAGCGCGCAGAGAGCTTTAATGTTGCCAACCTGA
TGCCGTTAGTGGCGGATAACCCCCTGACACCGGCAGGTCTGCTGGCACCCACCTACCGTAACCAGCTGGC
GTTTATCGATATTTTCTTCCGGGGGATGAATAACACCAACTACAACATGGCGGTCTGTGGCACCTCCGGG
GCCGGTAAAACCGGGCTGATACAGCCACTTATCCGCAGCGTGCTGGACTCCGGGGGCTTTGCCGTGGTGT
TCGACATGGGGGATGGCTACAAGTCCCTGTGTGAGAACATGGGTGGCGTATATCTGGACGGTGAAACCCT
GCGTTTTAACCCGTTTGCGAACATCACCGATATTGACCAGTCAGCGGAGCGTGTCCGTGACCAGTTGTCA
GTGATGGCCAGCCCCAACGGTAACCTGGATGAAGTGCATGAAGGTCTGCTGCTGCAGGCGGTCAGGGCCT
CCTGGCTGGCCAAAGAGAACAGGGCACGTATTGATGACGTGGTGGATTTCCTGAAAAACGCCAGTGACAG
CGAGCAGTATGCCGGGTCACCGACCATCCGCAGCCGTCTGGACGAAATGATTGTGCTGCTTGACCAGTAC
ACTGCCAACGGCACTTACGGCCAGTATTTTAACTCCGATGAGCCGTCCCTGCGGGATGATGCGAAAATGG
TGGTGCTGGAGCTGGGCGGACTGGAAGACCGTCCGTCACTGCTGGTTGCGGTGATGTTCTCCCTGATTAT
CTACATCGAGAACAGGATGTACCGCACGCCGCGTAACCTCAAGAAACTGAACGTTATTGATGAAGGCTGG
CGTCTGCTGGACTTCAAAAATCGCAAGGTCGGTGAGTTTATTGAGAAAGGTTACCGTACCGCCCGCCGTC
ATACCGGTGCCTATATCACCATCACACAGAACATCGTCGACTTTGACTCTGACAAGGCCTCCAGTGCGGC
CCGTGCGGCATGGGGTAACTCCTCCTACAAAATTATCCTCAAACAGAGTGCGAAGGAGTTCGCAAAATAC
AACCAGCTGTATCCGGACCAGTTCCAGCCACTGCAGCGCGACATGATTGGTAAGTTTGGTGCGGCCAAAG
ACCAGTGGTTCAGTTCCTTCCTGCTGCAGGTGGAAAACCATTCCTCCTGGCACCGCCTGTTTGTGGACCC
GTTAAGCCGCGCCATGTACAGCTCTGACGGCCCGGATTTTGAGTTTGTGCAGCAGAAACGTAAAGAGGGG
CTGAGTATTCATGAGGCGGTGTGGCAGCTGGCGTGGAAGAAGTCAGGGCCGGAGATGGCTTCGCTGGAAG
CCTGGCTGGAAGAACATGAGAAATACAGGAGTGTTGCATGA
 Primer design