SecReT4
Protein ID: 133756528
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81088
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]63014..64006 [+]
Productconjugal transfer protein
Component typeTraU_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.4e-84, Aligned region: 29..329
Protein Sequence: 330 a.a.     [Download]
>gi|133756528|ref|YP_001096484.1| conjugal transfer protein [Escherichia coli]
MKRSLWLLMLFLLAGHVPAASADSACEGRFVNPITDICWSCIFPLSLGSIKVSQGKVPDTANPSMPIQIC
PAPPPLFRRIGLAIGYWEPMALTDVTRSPGCMVNLGFSLPAFGKTAQGTAKKDEKQVNGAFYHVHWYKYP
LTYWLNIITSLGCLEGGDLDIAYLSEIDPTWTDSSLTTILNPEAVIFANPIAQGACAADAIASAFNMPLD
VLFWCAGSQGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERW
RYQMVNMYPDSGQCHPFGRSVMRWETGKNPPNTKKNFGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|133756440|ref|NC_009133.1|:63014-64006 Escherichia coli plasmid NR1, complete sequence
ATGAAGCGAAGCCTGTGGCTGCTGATGTTATTCCTTCTCGCCGGTCATGTCCCTGCGGCATCTGCGGATT
CTGCCTGTGAGGGGCGTTTTGTAAACCCGATCACGGATATCTGCTGGAGCTGTATTTTCCCGCTCTCGCT
GGGCAGTATCAAAGTCAGTCAGGGTAAGGTCCCCGACACGGCGAACCCGTCGATGCCCATTCAGATTTGT
CCGGCACCGCCGCCGCTGTTCAGGCGTATCGGGCTGGCCATTGGTTACTGGGAGCCGATGGCGCTGACGG
ACGTCACCCGGTCACCGGGATGCATGGTGAACCTGGGCTTCAGCCTGCCGGCTTTTGGTAAAACGGCACA
GGGAACGGCGAAAAAGGATGAGAAGCAGGTGAACGGGGCGTTCTATCACGTTCACTGGTACAAATACCCG
CTGACGTACTGGCTTAACATCATCACATCGCTGGGCTGTCTGGAAGGTGGTGACCTGGATATCGCTTATC
TTTCTGAAATTGACCCCACCTGGACGGACAGCAGCCTGACCACCATTCTCAATCCGGAAGCTGTCATCTT
TGCCAATCCGATAGCACAGGGGGCCTGTGCAGCAGATGCCATTGCCAGCGCCTTTAATATGCCTCTCGAT
GTTCTGTTCTGGTGTGCCGGTTCGCAGGGCAGTATGTACCCGTTCAATGGCTGGGTGAGTAATGAGTCCA
GTCCGTTGCAGTCCTCCCTGCTGGTCAGTGAACGCATGGCGTTCAAACTACACCGTCAGGGCATGATTAT
GGAAACCATCGGGAAAAATAACGCCGTCTGTAATGAATATCCGTCCCCAATCCTGCCTAAAGAACGCTGG
CGTTATCAGATGGTGAATATGTATCCGGACAGCGGACAGTGCCATCCGTTCGGGCGCAGTGTGATGCGCT
GGGAGACGGGAAAAAATCCGCCCAACACAAAGAAAAACTTCGGCTACCTGATGTGGCGTAAACGTAACTG
TGTATTCCTGTAA
 Primer design