SecReT4
Protein ID: 133756530
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81090
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]64350..64988 [+]
Productconjugal transfer protein
Component typeTrbC_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 4.7e-28, Aligned region: 93..191
Protein Sequence: 212 a.a.     [Download]
>gi|133756530|ref|YP_001096486.1| conjugal transfer protein [Escherichia coli]
MNRKIFALFALTAGMHLAVHASENVNTTENRQFLKQQENLSRQLREKPDHQLKAWAEKQVLENPLQRSDN
HFLDELVRKQQASQDGKPRQGALYFVSFSIPEEGLKRMLGETRHYGIPATLRGMVNNDLKTTAEAVLSLV
KDGATDGVQIDPTLFSQYGIRSVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGDS
GK
 
Nucleotide Sequence: 639 bp     [Download]
>gi|133756440|ref|NC_009133.1|:64350-64988 Escherichia coli plasmid NR1, complete sequence
ATGAACCGGAAAATATTTGCACTTTTTGCTCTGACAGCAGGGATGCATCTTGCTGTTCATGCTTCAGAAA
ATGTGAACACAACTGAAAACCGCCAGTTCCTGAAGCAGCAGGAAAATTTAAGCAGACAACTGCGAGAGAA
ACCTGACCATCAGCTGAAAGCCTGGGCGGAGAAACAGGTGCTGGAAAACCCCCTTCAGCGTTCAGATAAC
CATTTTCTGGATGAGCTGGTTCGTAAACAGCAGGCTTCGCAGGACGGGAAACCCCGGCAGGGTGCCCTGT
ATTTTGTGTCGTTTTCCATTCCCGAAGAGGGGCTGAAACGGATGCTGGGCGAAACCCGGCACTACGGTAT
ACCCGCCACACTGCGGGGCATGGTGAACAATGACCTGAAGACCACCGCTGAAGCCGTGCTGTCCCTGGTG
AAAGACGGCGCGACTGATGGTGTTCAGATCGACCCGACGCTGTTTTCACAGTACGGCATTCGCAGTGTAC
CGGCACTGGTGGTGTTCTGCAGTCAGGGATACGACATCATCCGGGGAAACCTGCGGGTCGGCCAGGCGCT
GGAGAAAGTGGCCGCCACGGGTGACTGCCGGCAGGTGGCTCATGATTTACTGGCAGGGAAAGGAGATTCC
GGGAAATGA
 Primer design