SecReT4
Protein ID: 133756531
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81091
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]64985..66835 [+]
Productconjugal transfer protein
Component typeTraN_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.4e-77, Aligned region: 321..566
Protein Sequence: 616 a.a.     [Download]
>gi|133756531|ref|YP_001096487.1| conjugal transfer protein [Escherichia coli]
MKRILPLILALVAGMAQADSNSDYRAGSDFARQIQGQGTGSIQGFKPQESIPSYNANPDETKYYGGVTAG
GDGGLKNDGTTEWATGETGKTITESFMNKPKDILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQEINRS
EFTNYTCERDTMVEEYCTRTASITGDWKYTDEYREVTIPHSQFRFSMNGLKLVFSVTAPVTGTVESASLS
VYAAFFFLNSRYTFMNTTFNVGLANGQSDTYPLSGATGLQVTQGQVLTGSGCTANGNCLPHGNGDRKVYE
SLVSGASTFTLKLRMKVRDKEWVPRVEWVESCPFNKADGVLTGTECSEPGGTKTGVMEGKPWNITQACWA
YRDKYVTQSADNGTCQKYVDNPACTLASRQCAFYSDEGTCLHEYATYSCESRTSGKVMVCGGDVFCLDGE
CDKAQSGKSSDFGEAVSQLAALAAAGKDVAALNGVDVRAFTGEAKFCRKAAAGFSNCCKDGGWGQDVGLA
KCNSEEKALGKAKDNKLTVSVGEFCSKKVLGVCLQKKRSYCQFDSKLAQIVQQQGRNGQLRIGFGSAKHP
DCRGITVDELQKIQFDRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|133756440|ref|NC_009133.1|:64985-66835 Escherichia coli plasmid NR1, complete sequence
ATGAAACGTATTTTACCTCTGATACTGGCTCTGGTTGCCGGCATGGCACAGGCTGACAGCAACAGTGATT
ACCGGGCCGGTTCTGATTTTGCCCGTCAGATTCAGGGGCAGGGTACAGGCAGTATTCAGGGCTTTAAGCC
ACAGGAGAGTATCCCCAGCTATAACGCGAATCCGGACGAGACAAAATATTACGGTGGCGTGACTGCCGGC
GGGGATGGCGGCCTGAAAAATGACGGCACCACGGAATGGGCGACCGGTGAAACCGGAAAAACCATCACAG
AGTCCTTCATGAACAAGCCGAAAGACATTCTGTCACCGGATGCACCGTTCATTCAGACCGGCAGGGATGT
GGTGAACCGGGCTGACAGCATTGTGGGAAATACCGGACAGCAGTGCAGTGCGCAGGAGATAAACCGCAGT
GAATTCACAAACTATACCTGTGAGCGGGACACGATGGTGGAGGAGTACTGCACACGGACTGCCAGTATCA
CCGGGGACTGGAAATACACGGATGAATATCGTGAAGTGACGATACCGCACTCACAGTTCCGGTTCAGTAT
GAACGGGCTGAAACTGGTGTTCAGTGTCACGGCTCCGGTAACCGGTACAGTGGAAAGTGCATCATTGTCT
GTATACGCCGCTTTTTTCTTCCTGAACTCCCGTTATACCTTCATGAATACAACCTTTAATGTCGGCCTGG
CAAACGGGCAGTCGGATACTTACCCCCTGTCCGGGGCGACAGGTTTGCAGGTGACACAGGGGCAGGTTCT
GACCGGTAGTGGCTGTACTGCTAACGGTAATTGCCTCCCGCACGGGAATGGTGACAGGAAAGTCTATGAA
TCGCTTGTCAGTGGTGCTTCCACCTTTACGCTGAAACTCAGGATGAAGGTCCGTGATAAAGAATGGGTTC
CCCGGGTGGAGTGGGTGGAGAGTTGTCCGTTTAATAAAGCGGATGGCGTGCTGACAGGCACTGAGTGTTC
AGAGCCGGGTGGTACGAAAACCGGAGTGATGGAAGGTAAACCCTGGAACATCACACAGGCATGCTGGGCA
TACCGGGATAAATATGTCACTCAGTCCGCAGATAACGGCACCTGTCAGAAATATGTCGATAATCCGGCCT
GTACGCTGGCCTCACGTCAGTGCGCGTTTTATTCCGATGAGGGAACCTGTCTGCATGAGTACGCCACGTA
CTCCTGCGAGTCCAGAACATCAGGAAAAGTGATGGTCTGTGGTGGTGATGTCTTCTGCCTTGACGGTGAA
TGCGATAAGGCACAGAGCGGAAAAAGCAGTGATTTTGGTGAAGCAGTATCACAGCTGGCTGCGCTTGCCG
CCGCAGGTAAGGATGTTGCCGCCCTGAATGGTGTGGATGTCAGGGCTTTCACGGGTGAGGCGAAATTCTG
CCGTAAGGCCGCAGCCGGCTTCAGTAACTGCTGTAAGGATGGTGGCTGGGGTCAGGATGTGGGTCTGGCG
AAGTGCAACAGCGAAGAAAAGGCGCTGGGAAAGGCAAAGGACAACAAACTGACCGTCAGTGTCGGAGAGT
TCTGTTCGAAGAAAGTGCTGGGTGTCTGTCTGCAGAAAAAGCGCAGCTACTGCCAGTTTGATTCGAAGCT
GGCGCAGATAGTCCAGCAGCAGGGGCGTAACGGGCAGTTGCGTATCGGGTTTGGCAGTGCGAAGCATCCT
GACTGTCGGGGGATTACGGTTGATGAGCTGCAGAAAATTCAGTTCGACAGACTGGATTTCACTAACTTCT
ACGAAGACCTGATGAATAACCAGAAAATCCCGGACAGTGGCGTTCTGACGCAGAAAGTGAAAGAGCAGAT
TGCTGACCAGCTGAAACAGGCAGGACAGTAA
 Primer design