SecReT4
Protein ID: 133756533
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81093
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]67094..67855 [+]
Productconjugal transfer protein
Component typeTraF_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.4e-79, Aligned region: 29..243
Protein Sequence: 253 a.a.     [Download]
>gi|133756533|ref|YP_001096489.1| conjugal transfer protein [Escherichia coli]
MMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQTATKR
ALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQR
QAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVK
YFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 762 bp     [Download]
>gi|133756440|ref|NC_009133.1|:67094-67855 Escherichia coli plasmid NR1, complete sequence
ATGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGT
CAGGGAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCTGT
ACCTGCAGCCCCCCGTCAGGAGCCGGATATTATGCAGAAACTGGCCGCGCTGCAGACGGCAACAAAGCGG
GCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTTAAATATTTCCGGCTGCAGAATTACT
GGACTCAGCAGGCCGGGCTTTTCACCATGAGTGCTAAAAAGGCCATGCTGGCACATCCCGAACTGGACTA
TAACCTGCAGTACAGCCATTACAACGGCACGGTACGGAACCAGCTGGCGGCAGACCAGGCGCAGCAGCGA
CAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTCTTTTACCGGGGGCAGGACCCCATCGACG
GGCAACTGGCGCAGGTCATTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTATTCCCGTTTCCGTGGA
TGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGTGTGAAA
TATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCATACGGCTTTATTT
CACAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCGAATTTTTAA
 Primer design