SecReT4
Protein ID: 133756535
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81095
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]68332..68616 [+]
Productpilin chaperone protein
Component typeTraQ_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 5.7e-50, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|133756535|ref|YP_001096491.1| pilin chaperone protein [Escherichia coli]
MISKYRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSLE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|133756440|ref|NC_009133.1|:68332-68616 Escherichia coli plasmid NR1, complete sequence
ATGATAAGTAAATACAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCACGTGTCAGCCTGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design