SecReT4
Protein ID: 133756539
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81099
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]69776..71158 [+]
Productconjugal transfer protein
Component typeTraH_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 3.1e-118, Aligned region: 32..381
Protein Sequence: 460 a.a.     [Download]
>gi|133756539|ref|YP_001096495.1| conjugal transfer protein [Escherichia coli]
MAIMLRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQPGVWQGQAAGYAYGGSLYARTQV
KNIQLISMTLPDINAGCGGIDAYLGSFSFINGDQLQRFVKQIMSNAAGYFFDLALQATVPEIKTAKDFLQ
KMASDINSMNLSSCQVAQGIVGGLFPQTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGQSSSVRDKAS
DKDKERVLKNINIIWDSLSKNRMLDGNKELKEFIMTLTGTLIFGEDSEITPLPARTTDRDILRAIMEGGT
AKVYHCNDSDKCLKVVADANVTIARDKALKSQITKLLTSIQNKAVSDTPLDDREKGFISSTTVPVFKYLI
DPQMLGVSSSVVYQLTDYIGYDIMLQYIQELLQQARAMIATGNYPQTVLDSVLENLNQAQQQIAVFQGQV
KVQQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGSTL
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|133756440|ref|NC_009133.1|:69776-71158 Escherichia coli plasmid NR1, complete sequence
GTGGCAATAATGCTTCGCATTAAACCTCTTCTGGTTCTTTGTGCCGCTTTACTGACGGTCACACCCGCAG
CGTCAGCGGATGTGAACAGCGACATGAATCAGTTCTTTAATAAGCTGGGATTTGCTTCCAATACCACACA
ACCGGGCGTCTGGCAGGGGCAGGCCGCCGGGTATGCCTATGGTGGCTCCCTGTATGCCCGCACCCAGGTC
AAAAATATCCAGCTGATTTCCATGACGCTGCCGGATATCAATGCCGGATGTGGCGGCATCGACGCCTATC
TCGGCTCGTTCAGTTTTATTAATGGCGATCAGTTGCAGCGTTTTGTTAAGCAGATTATGAGCAACGCTGC
CGGTTACTTTTTTGACCTTGCCCTGCAGGCAACGGTGCCGGAAATCAAAACCGCAAAAGACTTCCTGCAG
AAAATGGCAAGCGACATTAACAGTATGAACCTCAGCTCCTGTCAGGTGGCGCAGGGGATTGTCGGAGGAT
TATTTCCTCAGACTCAGGTGTCACAGCAGAAGGTCTGTCAGGACATTGCCGGTGAGAGCAATATTTTTGC
TGACTGGGCCGCGTCCCGTCAGGGCTGCACGGTCGGAGGACAGTCATCGTCTGTTCGTGACAAGGCCAGT
GACAAAGATAAGGAACGGGTGCTGAAGAACATCAATATCATCTGGGACTCGCTGTCCAAAAACAGGATGC
TTGATGGTAACAAAGAACTGAAAGAATTTATTATGACGCTCACCGGTACGCTGATTTTTGGGGAAGACAG
CGAGATTACCCCCCTGCCGGCGCGTACCACTGACCGCGATATCCTCCGGGCGATTATGGAGGGGGGAACG
GCAAAAGTTTATCACTGCAACGATTCGGACAAGTGTCTGAAGGTGGTGGCGGATGCAAATGTGACCATCG
CCCGGGATAAAGCCCTGAAATCACAGATTACAAAACTGCTCACCAGTATTCAGAATAAAGCGGTGAGTGA
TACTCCACTGGATGACAGGGAAAAAGGCTTCATTTCCAGCACCACCGTCCCCGTCTTTAAATATCTTATT
GACCCGCAGATGCTCGGTGTATCCAGCAGCGTGGTTTACCAGCTGACGGACTATATCGGCTACGACATCA
TGCTCCAGTACATTCAGGAACTGCTTCAGCAGGCCCGGGCCATGATTGCCACCGGGAACTATCCACAGAC
CGTGCTGGACAGTGTGCTGGAGAATCTGAATCAGGCACAGCAACAGATTGCGGTTTTCCAGGGGCAGGTA
AAGGTCCAGCAGGATGCATTGCTGGTTGTTGACCGTCAGATGAGCTATATGCGCCAGCAGCTTTCCGCCC
GCATGCTCAGCCGTTACCAGAACAACTATCACTTCGGAGGGAGCACGCTGTGA
 Primer design