SecReT4
Protein ID: 133756540
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81100
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]71155..73977 [+]
Productmating pair stabilization protein
Component typeTraG_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2.9e-123, Aligned region: 3..450
Protein Sequence: 940 a.a.     [Download]
>gi|133756540|ref|YP_001096496.1| mating pair stabilization protein [Escherichia coli]
MNEVYVIAGGEWLRNNLNAIAAFMGTRTWDSIEKIALTLSVLAVAVMWVQRHNVMDLLGWVAVFVLISLL
VNVRTSVQIIDNSDLVQVHRVDNVPVGLAMPLSLTTRIGHAMVASYEMIFTQPDSATYSKTGMLFGANLI
VKSTDFLSRNPEIINLFQDYVQNCVLGDIYLNHKYTLEDLMASADPYTLIFSRPSPLRGVYDSNNNFITC
KDASVTLKDRLNLDTKTGGKTWHYYVQQIFGGRPDPDLLFRQLVSDSYSYFYGSSQSASHIMRQNVTMNA
LKEGITSNAARNGDTASLVSLATTSSMEKQRLAHVSIGHVLMRNLPMVQTILVGITIGIFPLLVLAAVFN
RLTLSVLRGYVFALMWFQTWPLLYAILNSAMTFYAKQNGAPVVLSELSQIQLKYSDLASTAGYISVMIPP
LSWMMVKGLGAGFSSVYSHFASSAISPTASAAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQT
GSGATATQTRDGNMVMDASGAMSRLPVGINATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNSLSQ
FGSNRGSSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATQELASRSTRASAGMYGDAHAE
WGVKPKILGVGGGLGVRGGGRAGIDWEDNDAHTASSNTQSSHNARHDIDARATQDFKEASDYFTSRKVSE
SGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEYAEMASRTESMSGQMSEDLSQQFAQYVMKHA
PQDAEAILTNTSSPEIAERRRAMAWSFVQEQVQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIADHQGH
QAIIDQRTQDSNIRNDVKHQVDNMVTEYKGNIGDTQNSVRGEENIVRGQYSELQNHHKTEALSQNNKYNE
EKSAQERMPGADSPQELMKRAKEYQDKYKQ
 
Nucleotide Sequence: 2823 bp     [Download]
>gi|133756440|ref|NC_009133.1|:71155-73977 Escherichia coli plasmid NR1, complete sequence
GTGAATGAAGTCTATGTGATTGCCGGTGGTGAGTGGTTACGCAATAACCTGAACGCCATTGCCGCCTTTA
TGGGGACCCGGACGTGGGATTCCATCGAAAAAATTGCGCTCACATTGTCTGTTCTCGCGGTGGCCGTGAT
GTGGGTACAGCGGCACAACGTGATGGATTTGCTGGGCTGGGTGGCCGTGTTTGTGCTTATCAGCCTGCTG
GTTAATGTCCGTACATCGGTGCAGATTATTGATAACAGTGACCTGGTCCAGGTTCACCGGGTGGATAATG
TGCCTGTCGGACTGGCGATGCCACTTTCACTGACGACCCGTATCGGGCATGCAATGGTGGCCAGTTACGA
GATGATATTCACCCAGCCTGACAGCGCCACCTACAGCAAGACAGGCATGCTGTTCGGGGCGAACCTGATT
GTGAAAAGCACCGATTTTCTGTCCCGGAATCCGGAAATCATCAATCTGTTTCAGGACTACGTCCAGAACT
GCGTGCTGGGGGATATTTACCTGAACCACAAATACACGCTGGAAGACCTGATGGCCTCCGCTGACCCCTA
CACGCTGATTTTTTCCCGGCCCAGCCCGCTACGGGGCGTTTATGACAGCAATAATAATTTCATAACCTGT
AAAGATGCGTCGGTCACGCTGAAAGACAGGCTGAATCTCGATACAAAGACGGGAGGCAAGACCTGGCATT
ATTATGTGCAGCAGATATTTGGCGGCAGACCGGACCCGGACCTGTTATTCAGGCAACTGGTGAGTGACAG
TTACAGTTATTTCTACGGCTCCAGCCAGTCTGCCAGTCATATTATGCGCCAGAACGTCACCATGAATGCC
CTGAAAGAGGGTATCACCAGTAATGCAGCCCGTAACGGTGATACCGCCAGCCTGGTCAGTCTGGCCACGA
CTTCGTCGATGGAGAAACAGCGTCTGGCACATGTCTCCATTGGTCATGTGCTGATGCGAAACCTGCCGAT
GGTGCAGACCATTCTGGTGGGCATTACCATTGGTATCTTCCCGCTCCTGGTACTGGCGGCTGTCTTCAAC
AGACTGACGCTGTCTGTTCTGAGAGGCTATGTGTTTGCTCTGATGTGGTTCCAGACCTGGCCGTTGCTGT
ATGCCATTCTGAACAGTGCCATGACATTCTATGCAAAGCAGAATGGTGCACCGGTCGTGCTCTCTGAACT
CTCTCAGATACAGCTGAAATACTCCGACCTGGCGTCCACTGCCGGATATATATCTGTCATGATACCCCCG
TTGTCATGGATGATGGTAAAAGGCCTTGGCGCAGGTTTTTCCAGCGTGTACAGCCATTTCGCTTCCTCTG
CTATCAGCCCGACTGCCAGTGCGGCAGGTAGTGTGGTTGACGGTAATTACTCCTACGGCAACATGCAGAC
GGAAAACGTGAACGGCTTCAGCTGGAGCACCAACAGCACCACGTCGTTTGGTCAGATGATGTACCAGACC
GGCAGTGGCGCAACTGCCACACAGACCCGTGACGGTAATATGGTGATGGATGCGAGCGGGGCGATGTCCC
GGTTACCGGTCGGTATCAATGCAACGCGTCAGATTGCAGCGGCACAACAGGAAATGGCCCGGGAGGCGTC
GAACAGAGCAGAAAGCGCCCTGCATGGGTTCAGCAGCAGTATTGCCAGTGCCTGGAACTCGCTCAGCCAG
TTTGGTTCTAACCGGGGGAGCAGTGATTCTGTCACAGGTGGTGCTGACAGCACGATGAGCGCACAGGACT
CCATGATGGCCAGCCGTATGCGCAGTGCAGTGGAAAGCTATGCGAAGGCGCATAATATCAGTAATGAGCA
GGCGACTCAGGAACTGGCATCCAGAAGTACGAGAGCTTCTGCCGGGATGTATGGAGATGCTCATGCTGAA
TGGGGGGTTAAACCTAAAATTCTTGGTGTTGGTGGAGGATTAGGCGTTAGAGGTGGTGGTCGGGCTGGTA
TTGATTGGGAAGATAATGATGCGCATACGGCAAGTAGTAATACTCAGTCGAGCCATAATGCTCGTCATGA
TATCGATGCCAGAGCTACACAAGACTTTAAAGAGGCCAGCGATTATTTTACCAGTCGCAAGGTCAGTGAG
TCCGGCAGCCATACGGACAATAATGCTGATTCCCGTGTGGATCAGTTGTCTGCAGCCCTGAATTCAGCGA
AGCAGAGTTACGACCAGTACACGACGAATATGACCCGCAGCCATGAATATGCTGAAATGGCATCCCGTAC
TGAAAGCATGAGTGGGCAGATGAGTGAAGACCTGTCGCAACAGTTTGCACAGTATGTAATGAAACACGCG
CCACAGGATGCAGAAGCTATTCTGACAAACACCAGTTCACCGGAGATTGCAGAACGTCGTCGGGCGATGG
CCTGGTCTTTTGTGCAGGAACAGGTACAGCCTGGTGTTGATAATGCCTGGCGGGAATCCCGTGGTGATAT
TGGTAAAGGAATGGAGAGCGTACCTTCGGGTGGTGGCAGTCAGGATATTATTGCTGACCATCAGGGGCAT
CAGGCCATTATTGATCAAAGAACGCAGGACAGTAATATCCGTAATGATGTAAAACATCAGGTTGATAATA
TGGTCACAGAATATAAAGGGAATATAGGTGATACTCAGAACAGCGTACGTGGCGAGGAAAATATTGTAAG
AGGACAGTATTCTGAACTGCAGAATCACCATAAAACAGAGGCATTATCTCAGAATAATAAATATAATGAA
GAAAAGTCGGCTCAGGAAAGAATGCCCGGGGCTGACAGTCCACAGGAACTGATGAAAAGGGCAAAGGAAT
ATCAGGATAAGTATAAGCAATAA
 Primer design