SecReT4
Protein ID: 133756544
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81103
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]76249..78474 [+]
Productcoupling protein
Component typeTraD_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 5e-148, Aligned region: 172..561
TraD_N [PF12615], Evalue: 2.5e-33, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 1.1e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 2e-10, Aligned region: 187..491
T4SS-DNA_transf [PF02534], Evalue: 1e-07, Aligned region: 382..478
Protein Sequence: 741 a.a.     [Download]
>gi|133756544|ref|YP_001096500.1| coupling protein [Escherichia coli]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILIGLVLWVKISWQTFINGCIYWWCTSLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGDPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPEVASGEDVTQAEQPQQPQQPQQPQQ
PQQPQQPQQPQQPQQPQQPVSSVINDKKSDAGVSVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMA
AYEAWQQENHPDIQQHMQRREEVNINVHRERGEDVEPGDDF
 
Nucleotide Sequence: 2226 bp     [Download]
>gi|133756440|ref|NC_009133.1|:76249-78474 Escherichia coli plasmid NR1, complete sequence
ATGAGTTTTAACGCAAAGGATATGACCCAGGGCGGTCAGATTGCGTCCATGCGTATCCGCATGTTCAGCC
AGATCGCCAATATCATGCTTTACTGCCTGTTTATTTTTTTCTGGATCCTCATTGGTCTGGTCTTATGGGT
AAAAATAAGCTGGCAGACGTTTATCAACGGCTGTATTTACTGGTGGTGTACGTCACTGGAAGGCATGCGG
GATTTAATAAAATCCCAGCCGGTCTATGAGATCCAGTATTACGGCAAAACCTTCCGGATGAACGCTGCCC
AGGTACTGCATGATAAATATATGATCTGGTGCGGAGAGCAGCTATGGTCTGCATTCGTTCTGGCGTCTGT
CGTGGCCCTGGTTATTTGCCTGATCACCTTCTTTGTTGTCTCCTGGATTCTGGGGCGTCAGGGTAAACAA
CAGAGCGAAAATGAAGTCACAGGTGGTCGTCAGCTGACAGACAATCCGAAAGACGTTGCCCGGATGCTGA
AAAAAGACGGCAAGGACTCCGATATCCGGATTGGCGACCTGCCGATTATCCGGGATTCCGAAATCCAGAA
CTTCTGTCTGCACGGCACGGTCGGGGCCGGTAAGTCGGAGGTTATCCGTCGTCTGGCCAACTATGCCCGT
CAGCGCGGTGATATGGTGGTGATTTATGACCGTTCAGGGGAATTTGTTAAAAGTTACTATGATCCCTCCA
TCGATAAAATCCTGAATCCGCTGGATGCCCGCTGTGCCGCATGGGATTTGTGGAAGGAGTGCCTGACACA
GCCGGATTTTGATAATACCGCGAACACGCTGATCCCGATGGGTACAAAAGAGGACCCGTTCTGGCAGGGT
TCAGGACGTACCATTTTTGCGGAAGCGGCGTACCTGATGCGTAATGACCCCAACCGCAGCTACAGCAAAC
TGGTGGACACACTGCTTTCCATCAAAATTGAAAAACTGCGTACCTTCCTGCGTAATTCACCGGCGGCCAA
CCTGGTGGAAGAGAAAATTGAGAAAACGGCGATTTCCATCCGTGCTGTGCTGACCAACTACGTGAAAGCC
ATCCGTTACCTGCAGGGGATTGAGCATAACGGTGATCCCTTCACCATCCGTGACTGGATGCGTGGTGTCC
GGGAAGATCAGAAAAACGGCTGGCTGTTTATTTCGTCGAACGCCGACACCCATGCCTCCCTGAAGCCTGT
GATCTCCATGTGGCTGTCCATTGCCATTCGTGGTCTGCTGGCAATGGGAGAAAACCGTAACCGTCGTGTG
TGGTTTTTCTGTGATGAGTTACCCACGTTACACAAACTGCCGGATCTGGTGGAGATCCTGCCGGAAGCCC
GTAAGTTCGGTGGCTGTTATGTGTTTGGTATCCAGTCCTATGCCCAGCTGGAAGATATCTACGGTGAGAA
AGCGGCGGCCACGCTGTTTGACGTCATGAACACCCGTGCTTTTTTCCGTTCCCCGAGCCATAAGATTGCA
GAGTTCGCTGCCGGTGAGATTGGTGAGAAAGAGCACCTGAAAGCCAGCGAGCAGTATTCCTACGGTGCTG
ACCCGGTACGTGACGGGGTATCGACCGGTAAGGATATGGAGCGTCAGACGCTGGTCAGTTATTCCGACAT
TCAGTCTCTGCCGGATCTGACCTGCTATGTCACTCTGCCCGGACCGTATCCGGCAGTCAAACTCTCTCTG
AAATATCAGGCACGACCGAAGGTCGCTCCGGAGTTTATTCCGCGTGACATCAACCCGGAAATGGAGAACC
GTCTGAGTGCCGTACTTGCCGCAAGGGAAGCAGAAGGTCGTCAGATGGCCAGCCTCTTTGAACCGGAGGT
TGCCTCCGGAGAAGATGTGACTCAGGCTGAACAGCCACAACAGCCACAACAGCCACAACAGCCACAACAG
CCACAACAGCCACAACAGCCACAACAGCCACAACAGCCACAACAGCCACAACAGCCAGTGTCTTCTGTCA
TCAATGATAAGAAGTCAGATGCAGGTGTGAGTGTTCCGGCAGGGGGGATCGAGCAGGAGCTGAAAATGAA
ACCGGAAGAAGAGATGGAACAGCAACTGCCACCCGGGATCAGTGAATCCGGTGAAGTGGTGGATATGGCC
GCTTATGAGGCATGGCAACAGGAAAATCATCCGGACATCCAGCAGCATATGCAGCGTCGTGAAGAGGTGA
ACATTAATGTGCACCGGGAGCGCGGGGAGGATGTTGAGCCGGGAGATGATTTCTGA
 Primer design