SecReT4
Protein ID: 133756545
T4SS name [ID]Tra_F [99]
Gene symbol-
Locus tagD616_p81106
StrainEscherichia coli plasmid NR1 (NC_009133)
Repliconplasmid NR1 [GenBank: NC_009133] [Browse all T4SS(s) in this replicon]
Location [Strand]78474..83744 [+]
Productconjugal transfer nickase/helicase
Component typeTraI_F
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 9.8e-89, Aligned region: 7..287
TraI [PF07057], Evalue: 3.1e-59, Aligned region: 1434..1560
AAA_30 [PF13604], Evalue: 2.8e-42, Aligned region: 968..1156
UvrD_C_2 [PF13538], Evalue: 1.7e-05, Aligned region: 1341..1444
AAA_19 [PF13245], Evalue: 2.3e-05, Aligned region: 982..1047
Protein Sequence: 1756 a.a.     [Download]
>gi|133756545|ref|YP_001096501.1| conjugal transfer nickase/helicase [Escherichia coli]
MLSFSVVKSAGSAGNYYTDKDNYYVLGSMGERWAGQGAEQLGLQGSVDKDVFTRLLEGRLPDGADLSRMQ
DGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRLIDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQDPQLHTHVVVANVTQHNGEWKTLSSDKVGKTGFSENVLANRIAFGKIYQSELRQRVEA
LGYETEVVGKHGMWEMPGVPVEAFSSRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVRMAEWMQT
LKETGFDIRAYRDAADQRAEIRTQAPGPASQDGPDVQQAVTQAIAGLSERKVQFTYTDVLARTVGILPPE
NGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSVRALSRDIMKQNRVTVHPEKSVPRTAGYS
DAVSVLAQDRPSLAIVSGQGGAAGQRERVAELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGR
RQLQEGMVFTPGSTVIVDQGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRW
QGGEQRPATIISEPDRNVRYDRLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVLGHPEVT
MTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLTLRDAQGETQVVRISSLDS
SWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASVSEDAMTVVVPGRAEPATLPVADSPFTALKL
ENGWVETPGHSVSDSATVFASVTQMAMDNATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQI
KARAGETSLETAISLQKTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINA
QIKRGDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSGQRAATRMI
LETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPASERPRVVGLGPTHRAVGEMRSAGVDAQTLASFLHDT
QLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSA
ADVVIMKEIVRQTPELREAVYSLINRDVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQEAKLAEA
QQKAMLKGETFPDVPMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGKEQVM
VPVLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLISPREAVAEGVT
LYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQQTRVIRPGQERAEQHIDLAYAI
TAHGAQGASETFAIALEGTEGNRKLMAGFESAYVALSRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVL
EPKPDREVMNAQRLFSTARELRDVAAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAG
IWLNPLTTDDGNGLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDSSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEIVRKMAENKPDLP
DGKTEQAVREIAGQERDRADITEREAALPESVLRESQREQEAVREVARENLLQERLQQIERDMVRDLQKE
KTLGGD
 
Nucleotide Sequence: 5271 bp     [Download]
>gi|133756440|ref|NC_009133.1|:78474-83744 Escherichia coli plasmid NR1, complete sequence
ATGTTGAGTTTCAGCGTTGTTAAATCGGCAGGCAGTGCCGGAAACTATTACACCGACAAGGATAATTACT
ATGTGCTGGGCAGCATGGGAGAACGCTGGGCTGGTCAGGGGGCTGAACAGCTTGGGCTGCAGGGCAGCGT
CGATAAGGATGTTTTTACCCGTCTTCTGGAGGGCAGGCTGCCGGACGGGGCGGATTTAAGCCGCATGCAG
GATGGCAGTAATAAGCATCGTCCCGGCTACGACCTGACCTTCTCCGCCCCCAAAAGTGTCTCCATGATGG
CCATGCTCGGGGGGGATAAACGTCTTATTGATGCACATAACCAGGCCGTGGATTTTGCTGTCCGTCAGGT
GGAGGCGCTGGCTTCCACACGGGTGATGACGGACGGACAGTCAGAAACGGTGCTGACCGGTAATCTGGTG
ATGGCACTGTTTAACCATGACACCAGTCGCGATCAGGACCCACAGTTACACACGCATGTAGTGGTGGCTA
ATGTCACGCAGCATAACGGCGAGTGGAAGACACTGAGCAGTGACAAAGTGGGGAAAACCGGATTTTCCGA
GAACGTGCTAGCGAACCGGATTGCGTTCGGGAAAATATATCAGAGTGAGTTACGTCAGCGCGTTGAGGCG
CTGGGTTATGAAACCGAAGTGGTCGGTAAGCACGGTATGTGGGAGATGCCGGGCGTACCGGTGGAGGCCT
TTTCCAGTCGTTCACAGGCTATCAGGGAGGCCGTCGGTGAAGACGCCTCGCTGAAATCCCGGGATGTGGC
GGCACTGGATACGCGAAAATCCAAACAGCACGTCGATCCTGAAGTCAGAATGGCTGAATGGATGCAGACG
CTGAAGGAAACCGGGTTCGACATCCGGGCATATCGTGACGCGGCGGATCAGCGTGCGGAGATCCGCACGC
AGGCGCCCGGGCCTGCTTCACAGGACGGGCCGGATGTGCAGCAGGCGGTGACACAGGCGATTGCCGGATT
AAGTGAACGAAAAGTGCAGTTCACGTATACGGACGTGCTGGCCAGGACGGTCGGCATACTGCCGCCGGAA
AATGGTGTGATTGAACGGGCACGCGCCGGTATCGATGAGGCCATCAGCCGTGAGCAGCTTATCCCCCTCG
ACCGTGAGAAGGGGCTGTTCACATCAGGAATTCATGTGCTCGATGAGCTGTCCGTCCGGGCACTCAGTCG
TGACATCATGAAACAGAACCGGGTGACCGTACATCCGGAGAAAAGTGTCCCCCGGACGGCTGGTTACAGC
GATGCGGTCAGTGTTCTGGCACAGGACCGTCCGTCGCTGGCCATTGTGTCCGGGCAGGGCGGTGCAGCCG
GGCAGCGTGAGCGGGTGGCTGAACTGGTCATGATGGCCCGGGAGCAGGGGCGGGAGGTGCAGATTATCGC
TGCTGACCGTCGCTCGCAGATGAACCTGAAGCAGGATGAACGGCTGTCCGGTGAGCTGATAACCGGACGT
CGTCAGCTGCAGGAGGGCATGGTCTTCACGCCGGGCAGTACTGTTATCGTCGACCAGGGCGAAAAACTCT
CCCTGAAAGAGACGTTAACCCTGCTGGATGGTGCCGCACGTCATAACGTACAGGTCCTGATAACCGACAG
CGGGCAGCGAACCGGTACAGGCAGTGCGCTGATGGCCATGAAGGATGCCGGGGTGAACACGTATCGCTGG
CAGGGCGGAGAACAGCGACCGGCAACCATCATCAGTGAACCGGACCGGAATGTCCGCTATGACCGGCTGG
CCGGAGATTTTGCGGCCAGCGTGAAAGCCGGAGAAGAGAGCGTGGCACAGGTCAGCGGGGTACGGGAACA
GGCCATACTGACACAGGCCATTCGCAGTGAGCTGAAAACACAGGGCGTGCTCGGACACCCGGAGGTGACC
ATGACCGCCCTGTCACCGGTCTGGCTGGACAGCCGGAGCCGTTATCTGCGGGATATGTACCGACCGGGGA
TGGTGATGGAGCAGTGGAACCCGGAGACACGCAGTCATGACCGCTATGTTATCGACCGGGTGACGGCGCA
GAGTCACAGCCTGACCCTGCGGGATGCGCAGGGCGAAACGCAGGTGGTGCGTATTTCCTCCCTGGACAGC
AGCTGGTCGCTGTTCCGGCCGGAAAAAATGCCGGTGGCAGACGGCGAGCGACTGAGGGTGACAGGGAAAA
TTCCCGGACTCCGCGTCTCCGGCGGTGACCGCCTGCAGGTGGCATCCGTCAGTGAAGATGCGATGACGGT
TGTTGTGCCGGGGCGGGCTGAACCGGCCACCCTGCCTGTGGCTGATTCACCGTTCACGGCACTGAAGCTG
GAGAACGGCTGGGTGGAAACGCCCGGGCATTCCGTCAGTGACAGTGCGACGGTGTTTGCCTCCGTCACAC
AGATGGCAATGGACAACGCCACCCTGAACGGTCTGGCCCGCAGCGGTCGTGATGTCCGGCTGTATTCCTC
ACTGGATGAAACCCGTACTGCGGAAAAACTTGCCCGCCATCCCTCCTTTACGGTGGTTTCTGAGCAGATA
AAGGCGCGGGCCGGTGAGACATCGCTGGAAACCGCTATCAGTCTGCAGAAAACCGGGCTGCACACGCCGG
CACAGCAGGCCATTCATCTGGCCCTTCCTGTGCTGGAAAGTAAAAACCTGGCCTTCAGCATGGTGGACCT
GCTGACAGAGGCGAAGTCGTTTGCTGCAGAAGGAACCGGTTTTACTGAACTGGGAGGGGAAATCAATGCG
CAGATAAAACGCGGTGACTTACTGTATGTGGATGTGGCAAAAGGCTATGGCACAGGCCTGCTGGTTTCCC
GTGCGTCGTATGAGGCAGAAAAAAGTATTCTTCGCCATATTCTCGAAGGTAAGGAGGCGGTCACGCCGCT
GATGGAGAGAGTACCCGGCGAACTCATGGAGACGTTAACGTCGGGACAGCGTGCCGCCACCCGTATGATA
CTGGAAACGTCCGACCGTTTCACGGTGGTACAGGGTTATGCCGGTGTGGGTAAGACCACACAGTTCCGGG
CGGTGATGTCAGCCGTGAACATGCTGCCGGCGAGTGAGCGTCCCCGAGTTGTGGGGCTGGGGCCCACGCA
CCGTGCGGTCGGTGAGATGCGCAGCGCCGGCGTGGATGCACAGACGCTGGCGTCCTTTCTGCATGACACG
CAGCTGCAGCAGCGCAGCGGAGAAACGCCGGATTTCAGCAACACGCTGTTCCTGCTCGATGAGAGCTCAA
TGGTGGGCAATACCGACATGGCACGGGCATACGCCCTGATTGCGGCCGGTGGCGGTCGTGCCGTGGCCAG
TGGTGACACGGACCAGCTGCAGGCCATCGCGCCCGGTCAGCCTTTCCGTCTCCAGCAGACGCGCAGTGCT
GCCGATGTGGTCATCATGAAGGAGATTGTGCGTCAGACGCCGGAACTGCGGGAGGCGGTATACAGCCTGA
TTAACCGGGATGTGGAAAGGGCACTGTCCGGGCTTGAGAGTGTGAAACCGTCTCAGGTTCCCCGTCAGGA
GGGCGCATGGGCACCGGAGCACTCCGTGACGGAGTTCAGTCACAGCCAGGAAGCGAAACTGGCAGAAGCG
CAGCAGAAGGCGATGCTGAAAGGTGAGACTTTTCCGGATGTCCCCATGACACTGTATGAAGCCATTGTCC
GCGACTATACCGGCAGGACACCGGAAGCACGGGAGCAGACGCTGATTGTCACGCACCTGAATGAGGACCG
GCGCGTACTGAACAGCATGATTCATGATGCACGGGAAAAGGCCGGTGAGCTGGGGAAAGAGCAGGTCATG
GTGCCTGTCCTGAACACAGCGAATATACGTGACGGGGAGCTGCGTCGTCTCTCCACCTGGGAGAATAACC
CGGATGCCCTTGCCCTGGTGGATAGTGTGTATCACCGGATTGCCGGTATCAGCAAGGATGACGGGCTGAT
AACCCTGGAGGATGCGGAAGGTAACACGCGGCTGATTTCGCCCCGGGAGGCGGTGGCTGAAGGTGTCACA
CTGTACACCCCGGACAAAATCCGGGTGGGGACCGGCGACCGGATGCGCTTCACGAAGAGTGACCGGGAGC
GCGGTTATGTGGCCAACAGCGTCTGGACGGTGACAGCGGTTTCCGGTGACAGTGTCACGTTGTCAGACGG
ACAGCAGACCCGGGTGATTCGCCCCGGCCAGGAGCGGGCAGAGCAACATATTGACCTGGCTTATGCCATC
ACCGCCCACGGTGCGCAGGGGGCGAGTGAAACCTTTGCCATCGCGCTTGAAGGCACGGAAGGTAACCGGA
AACTGATGGCCGGCTTTGAGTCAGCCTACGTGGCCCTGTCGCGTATGAAGCAGCATGTGCAGGTGTACAC
CGATAACCGTCAGGGCTGGACGGATGCCATTAACAATGCCGTACAGAAAGGAACTGCCCACGATGTGCTG
GAGCCGAAACCGGACCGGGAGGTCATGAATGCGCAGCGGCTGTTCAGTACGGCACGGGAACTGCGGGACG
TGGCGGCAGGCCGTGCCGTTCTCCGTCAGGCAGGGCTGGCCGGGGGAGACAGCCCTGCACGGTTTATTGC
ACCGGGACGTAAATATCCGCAGCCGTATGTGGCACTGCCGGCGTTTGACCGTAACGGCAAGTCCGCCGGT
ATCTGGCTGAACCCACTGACCACGGATGACGGAAACGGGCTGCGGGGATTCAGCGGTGAAGGACGGGTGA
AAGGCAGCGGGGATGCGCAGTTCGTGGCCCTGCAGGGTAGCCGTAACGGAGAGAGCCTGCTGGCTGATAA
TATGCAGGATGGTGTCCGGATTGCCCGTGATAATCCTGACAGCGGTGTGGTGGTAAGAATTGCCGGTGAA
GGTCGTCCGTGGAATCCCGGTGCCATCACCGGTGGTCGCGTGTGGGGGGATATCCCGGACAGCAGCGTCC
AGCCGGGAGCCGGAAATGGCGAACCGGTCACGGCAGAGGTGCTGGCACAGCGGCAGGCTGAAGAGGCCAT
CCGCCGTGAAACGGAACGCCGTGCAGATGAAATTGTCCGTAAAATGGCAGAGAACAAACCTGACCTGCCG
GATGGCAAAACAGAGCAGGCTGTCAGGGAAATTGCCGGGCAGGAGCGTGACCGGGCTGACATAACTGAAC
GGGAAGCCGCGCTGCCGGAGAGTGTGCTGCGTGAATCACAACGGGAGCAGGAAGCGGTCCGGGAGGTTGC
CCGGGAAAATCTGCTGCAGGAGCGTCTGCAGCAGATAGAGCGGGATATGGTTCGTGACCTGCAGAAAGAG
AAAACCCTGGGCGGAGACTGA
 Primer design