SecReT4
Protein ID: 134044454
T4SS name [ID]Tra_F [587]
Gene symboltraG
Locus tagYR71pYR1_0177
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]149386..153000 [+]
Producttype IV conjugative transfer system protein TraG
Component typeTraG_F
UniProt IDA4IUK5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.9e-104, Aligned region: 5..469
Protein Sequence: 1204 a.a.     [Download]
>gi|134044454|ref|YP_001101871.1| type IV conjugative transfer system protein TraG [Yersinia ruckeri]
MGAFSIHSIGDSAFLEQILIAVSMITGTGDFEKMVSIGLLLGVLMICIQSVFQGAKQINLQQVLVGWILY
ACFFGPTTTVTIEDAYTGQVRVVANVPIGVGFAGGVISNVGYTITNLFETGYGVIVPNVTESHFSETLKL
LNDVRRRAYDTGVFTALNSANGGGYVDVRRSWNNYIRECTLTKVDLNLMSLDELMNRSTDSALRFNSQLY
GTRLYLSTSNPDGADYTCTDGWVAISTATANLSSPVVVDALNSLLGIDTSTGDNAITKLTDSLQAMGATT
TSSIDYLKAAVLEPLYYEAAAGRYQDLQDYGSALMINQAIQQRNTQWAAEQSMFMTVVRPMLTFFEGFIY
AITPIIAFIIVMGSFGLQLAGKYVQTILWIQLWMPVLSIINLFVHTAASNEMSSLSAGGLNSMYALSSTG
DVLQHWIATGGMLAAATPVISLFIVTGSTYAFTSLASRISGSDHVDEKMQTPDLLKQGPVMQSQPAYNHN
QFSGAIANGAESMISTFSLGSTLASGVSSAQALQSQKSEAFQSTLGRGFSDGVSQDQAYSRLSNVGRNVS
SQNTAQSQLINQQAKNFMDKFQVDDSHSDAVKGAFAMQAMGTLDVDEAASMLMPMVGKARAAMKAAAGVK
SNSTALVPAGGDGESGGGSDVLDIKAQAKGATESSAQDSSSWSASDVSQFMKGVSYSQTDSQALTNQLAQ
GFSRSGSESFKQTWGDSLSQNLSKSASELVSASDTFTTMSQLQNQMGSMTNTDFKTLGGAVAQTPAAMNQ
LNDYFRNAAPQSVKDEAASLQQRYQAYGMSPQVAQAAARMTAMTNSKNYEPGKELGGYQAALQAINTASG
RNGAFSGDAYGNNGIEGPNVQGLPGQVQGAVGSGPNIPTGFRENVAGMAGTNPASEAGQLPTNSPLVQNE
HAAGTSALHNQAQQTERNVSAPELKKAQDNLMNSLPEMSWSASAWGAWDNSTDWMGRRAEQAGGALIAGG
QAGADAFSKAMDQMRTMTPEQRDQFIAATQRGDQAVQEEFGWAGDAMVGMAKLGRNVMGAAASGYDAAKE
WLTGKSDLSEAAKGMSIEERGAFYAAALSSAAEAGGGAAQQFMNQYGDEFKETMQSIAQNRYGLTQAQAA
VYAESFDTNEGRMDQAVQNLKMEYAERNPDGSPMMQGGQPVLSQQNEEFTDKLVNVLQNSTGAGDRSGSY
LTAVRGYNIANQRF
 
Nucleotide Sequence: 3615 bp     [Download]
>gi|134044452|ref|NC_009139.1|:149386-153000 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
ATGGGAGCTTTTTCAATCCACTCTATCGGTGACTCTGCTTTTCTGGAGCAAATCCTGATTGCAGTATCAA
TGATCACCGGCACCGGAGACTTCGAGAAGATGGTCAGTATTGGCCTGCTTCTTGGGGTCTTGATGATCTG
TATTCAGTCCGTCTTTCAGGGCGCAAAGCAAATCAACCTCCAGCAAGTGCTGGTAGGTTGGATTCTATAT
GCCTGCTTTTTCGGTCCAACCACAACGGTGACTATCGAGGATGCGTACACAGGGCAGGTTCGAGTCGTCG
CCAATGTCCCTATTGGGGTGGGCTTTGCTGGAGGTGTCATATCCAACGTGGGATACACCATCACCAATTT
GTTTGAAACCGGATATGGAGTAATCGTACCCAATGTCACGGAAAGCCACTTTTCCGAAACACTGAAACTG
TTGAATGACGTCAGACGGCGAGCCTATGACACCGGGGTTTTCACTGCGCTTAATTCAGCAAATGGGGGCG
GCTATGTTGATGTGAGGCGTTCTTGGAACAACTACATTCGGGAATGCACGTTGACGAAAGTTGATCTCAA
CCTAATGTCCCTTGATGAGTTGATGAACCGTTCAACCGACTCAGCTTTGCGGTTCAACTCTCAGCTCTAC
GGAACCCGGTTGTATTTGTCCACATCAAACCCTGATGGCGCTGACTACACATGTACTGACGGATGGGTGG
CTATTAGCACTGCAACCGCCAACCTAAGCAGCCCGGTTGTTGTTGATGCTCTTAACAGCCTACTGGGTAT
TGACACATCAACTGGCGATAACGCTATAACGAAGCTAACTGACTCCCTGCAAGCAATGGGGGCCACAACT
ACGTCATCAATCGACTACCTGAAAGCCGCCGTTCTGGAGCCCCTTTATTATGAAGCCGCAGCAGGACGCT
ATCAGGACCTCCAGGACTATGGCTCTGCATTGATGATAAACCAAGCCATTCAGCAACGTAATACTCAGTG
GGCCGCAGAGCAGTCGATGTTCATGACCGTTGTCCGACCAATGCTGACGTTCTTTGAGGGCTTCATTTAC
GCTATCACCCCGATCATTGCTTTTATTATCGTGATGGGCAGCTTTGGCCTCCAGTTAGCCGGTAAATATG
TGCAAACCATCCTCTGGATTCAGCTATGGATGCCAGTCCTCTCAATTATCAACCTGTTTGTTCATACCGC
CGCGTCAAATGAGATGTCTAGTCTCAGTGCTGGTGGTCTCAACTCCATGTACGCACTTTCCTCAACTGGA
GATGTGCTGCAACACTGGATTGCAACCGGCGGCATGTTGGCTGCGGCCACTCCGGTGATTTCCCTGTTTA
TCGTCACAGGTAGCACCTACGCCTTCACCAGCTTGGCATCGAGAATAAGTGGTTCTGACCACGTTGACGA
AAAGATGCAAACGCCAGATCTACTCAAGCAAGGTCCGGTTATGCAAAGCCAACCAGCGTACAACCACAAC
CAATTCAGTGGTGCGATTGCAAACGGCGCTGAAAGCATGATCAGCACCTTCTCGCTTGGCTCCACCTTGG
CATCGGGCGTGAGCTCCGCACAGGCATTACAAAGTCAGAAATCGGAGGCTTTCCAAAGCACCCTCGGTCG
AGGTTTTTCTGATGGAGTAAGTCAGGATCAAGCCTATTCAAGACTCTCCAATGTCGGGCGCAACGTTTCG
TCGCAAAACACAGCTCAGAGCCAATTGATCAACCAGCAAGCCAAGAACTTCATGGATAAGTTCCAGGTGG
ATGATAGCCACTCTGATGCTGTCAAAGGTGCTTTTGCCATGCAGGCTATGGGCACACTCGATGTTGACGA
AGCTGCGTCCATGCTTATGCCTATGGTTGGTAAGGCCAGGGCAGCAATGAAGGCCGCTGCTGGTGTGAAA
TCAAACAGTACAGCCCTTGTTCCTGCTGGTGGTGATGGCGAATCAGGCGGCGGTAGTGATGTCCTGGACA
TCAAAGCGCAAGCGAAGGGGGCAACGGAGTCATCAGCTCAAGACTCGTCAAGCTGGTCAGCGAGTGATGT
GTCCCAGTTCATGAAGGGTGTGAGCTATTCGCAAACCGATAGCCAGGCGTTGACAAATCAATTGGCGCAG
GGTTTCAGCCGTTCTGGAAGCGAGTCATTTAAGCAAACCTGGGGTGACAGCTTATCCCAGAATCTGTCCA
AGTCGGCCTCTGAACTGGTGTCTGCATCAGACACCTTCACAACAATGAGTCAGCTCCAAAATCAAATGGG
CTCCATGACTAACACCGACTTTAAAACTCTCGGTGGTGCAGTGGCACAAACCCCTGCGGCCATGAACCAA
CTGAATGACTATTTCCGAAATGCCGCGCCGCAATCGGTTAAAGACGAGGCGGCTTCACTACAGCAAAGAT
ACCAAGCCTACGGAATGTCGCCTCAAGTGGCCCAAGCAGCAGCGCGAATGACAGCAATGACCAACTCCAA
AAATTACGAACCGGGTAAGGAGCTTGGCGGGTATCAAGCCGCACTACAGGCGATCAATACCGCGTCCGGT
CGCAATGGAGCATTTAGTGGTGATGCTTACGGAAATAACGGCATTGAAGGCCCGAATGTTCAAGGCCTAC
CAGGTCAGGTTCAAGGTGCTGTAGGCAGTGGACCTAACATCCCAACCGGGTTCCGGGAGAATGTGGCTGG
AATGGCTGGAACTAATCCGGCATCAGAAGCTGGTCAGTTACCAACAAATAGCCCCCTTGTTCAAAATGAA
CATGCAGCCGGTACGTCAGCTCTTCACAACCAAGCGCAGCAAACAGAGCGAAATGTATCTGCTCCTGAAC
TGAAAAAAGCCCAAGATAACCTTATGAACTCACTTCCGGAAATGTCTTGGAGCGCTTCGGCATGGGGGGC
TTGGGATAACTCCACTGACTGGATGGGCCGCAGAGCTGAACAAGCTGGTGGAGCTCTTATTGCTGGTGGT
CAAGCTGGCGCTGATGCGTTCTCAAAAGCAATGGATCAAATGAGAACGATGACGCCTGAGCAACGCGACC
AATTCATCGCGGCAACTCAACGCGGCGACCAGGCCGTTCAAGAAGAGTTTGGCTGGGCCGGTGACGCGAT
GGTTGGGATGGCTAAACTTGGCCGAAACGTCATGGGAGCTGCTGCAAGCGGCTATGATGCAGCTAAAGAA
TGGTTAACTGGTAAATCTGACCTATCAGAAGCCGCTAAAGGGATGAGCATTGAAGAACGCGGCGCGTTCT
ATGCAGCAGCTCTATCCTCTGCCGCAGAAGCCGGTGGTGGAGCGGCGCAGCAGTTTATGAACCAGTATGG
CGATGAGTTCAAAGAGACAATGCAGTCAATTGCTCAAAACCGCTATGGACTGACTCAAGCACAAGCTGCT
GTTTATGCTGAATCCTTTGATACAAACGAAGGACGCATGGATCAGGCAGTTCAGAACCTGAAAATGGAAT
ATGCAGAACGTAACCCGGATGGTTCACCAATGATGCAAGGTGGTCAGCCTGTTCTTTCTCAGCAGAACGA
AGAGTTTACAGACAAGCTGGTAAACGTATTGCAGAACTCGACAGGGGCAGGAGATCGTTCAGGAAGCTAC
TTGACTGCTGTCAGGGGGTACAACATAGCAAATCAGAGGTTCTAA
 Primer design