SecReT4
Protein ID: 134044488
T4SS name [ID]Tra_F [587]
Gene symboltraC
Locus tagYR71pYR1_0089
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]68869..71316 [+]
Producttype IV conjugative transfer system protein TraC
Component typeTraC_F
UniProt IDA4IUB7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 6.2e-58, Aligned region: 20..255
AAA_10 [PF12846], Evalue: 2.4e-54, Aligned region: 451..729
DUF87 [PF01935], Evalue: 3.7e-06, Aligned region: 452..591
Protein Sequence: 815 a.a.     [Download]
>gi|134044488|ref|YP_001101783.1| type IV conjugative transfer system protein TraC [Yersinia ruckeri]
MIVTIKKKLEETLIPEHLRAAGIIPVLAYDEDDHVFLMDDHSAGFGFMCEPLCGADEKVQERMNGFLNQE
FPSKTTLQFVLFRSPDINQEMYRMMGLRDGFRHELLTSVIKERINFLQHHTTDRIFAKTNKGIYDNGLIQ
DLKLFVTCKVPIKNNNPTESELQQLAQLRTKVESSLQTVGLRPRTMTAVNYIRIMSTILNWGPDASWRHD
SVDWEMDKPICEQIFDYGTDVEVSKNGIRLGDYHAKVMSAKKLPDVFYFGDALTYAGDLSGGNSSIKENY
MVVTNVFFPEAESTKNTLERKRQFTVNQAYGPMLKFVPVLADKKESFDTLYESMKEGAKPVKITYSVVLF
APTKERVEAAAMAARNIWRESRFELMEDKFVALPMFLNCLPFCTDRDAVRDLFRYKTMTTEQAAVVLPVF
GEWKGTGTYHAALISRNGQLMSLSLHDSNTNKNLVIAAESGSGKSFLTNELIFSYLSEGAQVWVIDAGKS
YQKLSEMLNGDFVHFEEGTHVCLNPFELIQNYEDEEDAIVSLVCAMASAKGLLDEWQISALKQVLSRLWE
EKGKEMKVDDIAERCLEEENDQRLKDIGQQLYAFTSKGSYGKYFSRKNNVSFQNQFTVLELDELQGRKHL
RQVVLLQLIYQIQQEVFLGERNRKKVVIVDEAWDLLKEGEVSVFMEHAYRKFRKYGGSVVIATQSINDLY
ENAVGRAIAENSASMYLLGQTEETVESVKRSGRLTLSEGGFHTLKTVHTIQGVYSEIFIKSKSGMGVGRL
IVGDFQKLLYSTDPVDVNAIDQFVKQGMSIPEAIKAVMRSRQQAA
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|134044452|ref|NC_009139.1|:68869-71316 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
ATGATCGTAACCATCAAAAAGAAACTCGAAGAAACGTTGATCCCGGAGCACTTGCGAGCTGCCGGGATTA
TTCCTGTCCTGGCCTATGACGAAGACGATCATGTCTTCCTTATGGATGACCACAGTGCAGGCTTTGGTTT
CATGTGTGAGCCCCTGTGTGGTGCCGATGAAAAAGTTCAGGAGCGAATGAACGGTTTCCTGAATCAGGAG
TTCCCGTCGAAGACTACGCTCCAGTTTGTTCTGTTCCGCTCCCCGGACATCAATCAGGAGATGTACCGGA
TGATGGGGTTGCGTGATGGCTTCCGTCACGAGCTGCTGACATCTGTCATCAAGGAACGGATTAACTTCCT
CCAGCACCACACGACAGATCGCATATTTGCCAAGACCAACAAAGGTATCTACGACAATGGCTTGATCCAA
GACCTCAAGCTGTTCGTTACGTGCAAAGTCCCCATCAAGAACAATAACCCGACTGAAAGCGAACTCCAGC
AGCTCGCACAGCTTCGCACGAAGGTCGAATCATCGCTTCAAACCGTTGGTCTGCGTCCCCGCACAATGAC
GGCGGTGAACTACATCCGGATCATGAGCACCATCCTGAATTGGGGGCCGGATGCTTCATGGCGACATGAC
TCTGTGGATTGGGAGATGGATAAGCCCATCTGCGAGCAAATCTTCGATTACGGCACCGACGTGGAAGTCA
GCAAGAACGGCATCAGGCTGGGTGACTACCACGCGAAAGTCATGTCAGCGAAAAAGCTGCCTGACGTTTT
CTACTTTGGTGATGCGTTGACCTATGCCGGGGATCTCAGCGGCGGCAACTCCAGCATCAAAGAAAACTAC
ATGGTCGTGACCAATGTGTTTTTCCCAGAGGCAGAAAGCACGAAAAACACTCTGGAGCGCAAACGCCAGT
TCACTGTAAACCAAGCCTACGGGCCGATGCTCAAATTCGTGCCGGTGCTGGCGGACAAAAAGGAGAGCTT
CGACACTCTCTATGAGTCGATGAAAGAGGGGGCTAAGCCAGTCAAGATCACCTATTCGGTGGTTTTATTT
GCTCCAACCAAAGAACGTGTTGAAGCGGCGGCGATGGCCGCACGAAACATCTGGCGTGAATCTCGGTTCG
AGCTGATGGAGGATAAGTTCGTTGCTCTGCCGATGTTCCTCAACTGCCTGCCATTCTGTACCGACCGAGA
TGCAGTGCGAGACCTATTCCGCTACAAGACCATGACAACCGAGCAGGCTGCTGTGGTCCTGCCGGTGTTC
GGGGAATGGAAGGGGACCGGGACCTATCATGCTGCGCTGATTTCCCGCAACGGCCAGCTCATGAGTCTGT
CTCTTCACGACAGTAATACCAACAAGAACCTGGTGATCGCAGCCGAATCCGGCTCGGGTAAATCGTTCCT
TACCAACGAACTGATTTTTTCCTACTTGTCCGAGGGTGCTCAGGTCTGGGTTATTGATGCCGGTAAGTCC
TACCAGAAGCTGTCGGAAATGCTCAATGGCGACTTCGTTCACTTTGAAGAAGGAACGCACGTCTGCCTCA
ACCCGTTCGAGCTCATACAGAACTACGAGGACGAAGAAGACGCGATTGTCAGCCTCGTTTGTGCGATGGC
TTCGGCCAAAGGCTTGCTGGATGAATGGCAAATCTCTGCGCTGAAACAGGTCCTTTCTCGCCTGTGGGAA
GAGAAAGGTAAAGAGATGAAGGTTGACGACATCGCTGAGCGCTGCCTGGAAGAAGAAAACGACCAGCGCC
TCAAGGATATTGGTCAGCAGCTCTACGCCTTTACGTCGAAGGGTAGCTACGGGAAATACTTCTCTCGCAA
GAACAACGTCAGCTTCCAGAACCAGTTCACGGTACTGGAGCTCGATGAACTGCAAGGGCGTAAGCACTTG
CGTCAGGTTGTACTGCTCCAGCTTATTTACCAGATCCAACAAGAAGTATTCCTGGGTGAACGTAACCGCA
AGAAGGTCGTCATCGTGGATGAGGCCTGGGACCTGCTCAAAGAGGGTGAGGTCTCGGTCTTCATGGAACA
TGCCTACCGCAAATTCCGTAAGTACGGTGGCTCCGTTGTCATTGCAACGCAGTCCATCAACGACCTCTAT
GAGAACGCAGTGGGCCGCGCCATCGCGGAGAACTCGGCCAGCATGTACTTGCTCGGCCAAACCGAAGAAA
CCGTGGAATCTGTTAAACGTAGCGGTCGTCTGACCCTTTCAGAGGGCGGGTTCCACACCCTCAAAACGGT
ACACACCATCCAGGGCGTGTACTCAGAAATCTTTATCAAATCGAAGAGCGGTATGGGCGTCGGACGCTTG
ATAGTGGGCGACTTCCAGAAGCTGCTTTATTCGACCGATCCGGTGGACGTTAACGCCATCGACCAGTTTG
TGAAACAAGGCATGAGCATCCCTGAGGCAATCAAGGCCGTGATGCGAAGCCGTCAGCAGGCTGCATAA
 Primer design