SecReT4
Protein ID: 134044523
T4SS name [ID]Tra_F [587]
Gene symboltraE
Locus tagYR71pYR1_0082
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]58473..59099 [+]
Producttype IV conjugative transfer system protein TraE
Component typeTraE_F
UniProt IDA4IUB0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.4e-11, Aligned region: 27..170
Protein Sequence: 208 a.a.     [Download]
>gi|134044523|ref|YP_001101776.1| type IV conjugative transfer system protein TraE [Yersinia ruckeri]
MNLKKYLKTWEGTQTENKWGRIFQGGLIAIVFLLVVQVFSKETIVTIQPFTLTEEAWVTKNNASQSYKEA
WGFAFAQLLGNVTPGTVDFVKERITPLLSPSIYQDVIDAIEIQAQQIKNDRVTMRFEPRFVEYEPKSDKV
FVYGYSYVKGASSNEERSERSYEFAIKISNYAPVLDYIDTYVGKPRTKTVLEQLQRKEENRRKHEEQR
 
Nucleotide Sequence: 627 bp     [Download]
>gi|134044452|ref|NC_009139.1|:58473-59099 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
TTGAACCTGAAAAAGTATCTCAAGACCTGGGAAGGGACCCAAACAGAAAATAAGTGGGGACGAATCTTCC
AGGGTGGTCTTATTGCTATCGTTTTCCTGCTGGTGGTCCAAGTATTCAGCAAGGAAACCATCGTCACTAT
CCAGCCTTTCACGCTCACGGAAGAAGCCTGGGTGACGAAAAATAACGCCTCTCAGTCCTATAAAGAGGCT
TGGGGTTTCGCTTTTGCTCAGCTCCTTGGCAATGTGACGCCAGGAACCGTTGACTTTGTGAAAGAACGGA
TCACCCCGCTTCTCTCCCCGAGCATCTATCAGGACGTGATTGATGCCATCGAAATTCAAGCTCAACAGAT
CAAGAACGACCGCGTAACCATGCGGTTTGAGCCGCGTTTTGTTGAGTACGAGCCCAAGAGCGACAAGGTG
TTTGTCTACGGATATTCCTACGTCAAAGGGGCTTCTTCTAACGAAGAGCGTAGCGAACGCTCCTACGAGT
TCGCCATCAAGATTTCAAACTACGCGCCCGTGCTGGACTACATCGACACCTATGTAGGAAAGCCACGCAC
CAAAACTGTTTTGGAGCAACTCCAGCGCAAAGAAGAAAACCGGAGAAAGCATGAAGAACAACGCTAA
 Primer design