SecReT4
Protein ID: 134044544
T4SS name [ID]Tra_F [587]
Gene symboltraH
Locus tagYR71pYR1_0176
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]147940..149373 [+]
Producttype IV conjugative transfer system protein TraH
Component typeTraH_F
UniProt IDA4IUK4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 5e-103, Aligned region: 37..401
Protein Sequence: 477 a.a.     [Download]
>gi|134044544|ref|YP_001101870.1| type IV conjugative transfer system protein TraH [Yersinia ruckeri]
MVTHKILKRSLLALSVAASLVMAPTGAIAANGLQSQMDKLFNEMSNTTPPGVYESQRRGVLAGGRFTAKT
RIFDENLVSFAPPSWKAGCGGVDLFGGSLSFINADQIVQLLRAVAANAKGYAFQLALDNVFPDGAKWIEN
FQKKVQALNQHLGNSCQLAQGFVNDLTSGMDLKHKTDASITATTSGLYEDFFGSKQETSGKSPLEELKAN
KPDEYNKMIGNIVWKQLKSNNANTWFQYGDNTLLEAIMSLTGTVIIGDLVNDPNSTGTGAKTTPLTTLPG
NKITLSDLISGGSVEIYSCDSDTTNCLSAGSSNKTVVLKGIKNQITDMLLGTSSTPGVIYKYATNSGTLT
DPEKAFVSNLPGGIGTIVRNLSVLSQDGANLFATESSGAIALTMMYSFSEEFFRAARIAMANSKSPYKKE
ALELLAQSQQQIRAEYTILSSQYGDLASQIEKYNNLLDNIRKQKYMLATLSNPPSTN
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|134044452|ref|NC_009139.1|:147940-149373 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
ATGGTCACGCACAAGATATTAAAAAGGAGCCTGCTTGCCCTGAGTGTGGCGGCCAGTCTCGTCATGGCAC
CGACAGGGGCGATAGCGGCTAACGGCCTCCAATCACAAATGGACAAACTCTTCAATGAAATGAGCAACAC
AACACCACCTGGGGTTTATGAGAGCCAACGACGTGGCGTTTTAGCTGGTGGCCGGTTCACTGCAAAGACA
CGAATCTTCGACGAGAACCTGGTGAGCTTTGCCCCTCCATCATGGAAAGCTGGTTGCGGTGGTGTAGATC
TGTTCGGCGGTTCGCTTTCCTTCATTAACGCGGATCAAATTGTCCAACTCCTTCGGGCTGTAGCAGCCAA
CGCCAAGGGCTATGCCTTCCAGCTTGCGCTCGATAACGTTTTCCCGGACGGAGCGAAGTGGATAGAGAAC
TTCCAGAAGAAAGTGCAAGCGCTCAACCAACATCTGGGCAACTCCTGCCAGCTCGCTCAAGGTTTCGTGA
ACGACCTAACCAGTGGCATGGACCTTAAACACAAAACTGATGCTTCTATAACCGCGACAACTTCCGGCCT
GTATGAAGACTTCTTCGGGTCCAAGCAGGAAACCAGCGGCAAGAGTCCCCTGGAAGAACTGAAAGCCAAT
AAGCCTGACGAATACAACAAGATGATTGGCAACATCGTCTGGAAGCAACTCAAGAGCAACAACGCCAACA
CCTGGTTCCAGTACGGGGATAACACCCTTCTTGAAGCGATCATGTCTTTAACCGGCACAGTCATCATTGG
TGATCTGGTAAACGACCCGAACTCAACCGGCACTGGTGCGAAAACAACCCCTCTGACGACCCTACCAGGT
AACAAGATCACCTTGTCAGACCTGATTTCAGGCGGTTCTGTTGAGATCTATTCCTGTGATTCTGATACGA
CCAACTGCCTGAGTGCTGGCTCCAGCAATAAAACTGTCGTGCTCAAAGGTATCAAGAACCAGATCACCGA
CATGCTATTGGGAACCAGTTCTACGCCTGGCGTCATCTACAAATACGCAACGAACTCTGGAACCTTAACC
GACCCAGAAAAGGCCTTTGTTTCTAACCTCCCTGGAGGGATTGGCACCATCGTTCGTAATTTGTCTGTCC
TTTCACAGGACGGCGCTAACCTGTTCGCAACAGAGTCATCAGGAGCGATAGCCCTGACCATGATGTATAG
CTTCTCGGAAGAGTTCTTCCGTGCAGCTCGCATTGCGATGGCTAATAGCAAATCGCCCTACAAGAAAGAG
GCACTGGAGCTTCTCGCGCAATCGCAACAGCAAATCCGCGCTGAATACACAATTCTGTCCTCTCAATACG
GCGACCTGGCAAGCCAGATTGAGAAATACAACAACCTACTGGACAACATCCGCAAGCAAAAATACATGCT
GGCAACTTTGTCCAATCCTCCTAGCACGAACTAA
 Primer design