SecReT4
Protein ID: 134044575
T4SS name [ID]Tra_F [587]
Gene symboltraA
Locus tagYR71pYR1_0086
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]61901..62284 [+]
Producttype IV conjugative transfer system protein TraA
Component typeTraA_F
UniProt IDA4IUB4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.9e-06, Aligned region: 10..102
Protein Sequence: 127 a.a.     [Download]
>gi|134044575|ref|YP_001101780.1| type IV conjugative transfer system protein TraA [Yersinia ruckeri]
MNANQLANASSKNNALFLFLGLMVVAFLLVPDQAHAGTGGTAFDDVWVTLKDWTQGTLGRIVAGAMILVG
VVGGIARQSLMAFAMGIGGGMGLYNSPTVVESIMSATLEHAEKVIPAVVQLSNGLGV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|134044452|ref|NC_009139.1|:61901-62284 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
ATGAACGCAAATCAGTTGGCGAATGCCTCAAGTAAAAACAACGCACTCTTCCTCTTCCTGGGGTTGATGG
TGGTAGCCTTCCTGCTCGTGCCGGATCAGGCCCACGCTGGTACTGGTGGTACAGCGTTTGACGACGTATG
GGTAACTCTCAAGGATTGGACCCAAGGTACTTTGGGTCGAATCGTTGCGGGTGCGATGATCCTGGTCGGT
GTTGTTGGTGGTATCGCTCGCCAGAGCCTCATGGCTTTCGCTATGGGTATCGGTGGCGGTATGGGCCTGT
ACAACTCCCCGACCGTAGTGGAATCCATCATGTCTGCTACTCTGGAACATGCAGAGAAGGTCATCCCGGC
TGTTGTGCAACTCAGCAATGGCCTGGGGGTGTAA
 Primer design