SecReT4
Protein ID: 134044579
T4SS name [ID]Tra_F [587]
Gene symbol-
Locus tagYR71pYR1_0180
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]154387..154920 [+]
Producttransglycosylase SLT domain-containing protein
Component typeOrf169_F
UniProt IDA4IUK8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 177 a.a.     [Download]
>gi|134044579|ref|YP_001101874.1| transglycosylase SLT domain-containing protein [Yersinia ruckeri]
MKNKAKALVLSAALLSSTANAIDLSGTIFDKAAKAYNLDPLLVYSVALAESASGRGNGSISPWPWTLRVP
GLPFYAKSEDQAKAKLAEFQQQYGRAIDVGFMQVSIRWNGHRVSSPADLLDPETNVMVGAEVLSEAIQSS
PNDLELGVGRYHAWEDEIRARNYGSRVLAIYRNLRDL
 
Nucleotide Sequence: 534 bp     [Download]
>gi|134044452|ref|NC_009139.1|:154387-154920 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
ATGAAGAACAAAGCCAAGGCGCTGGTTCTGTCTGCGGCTCTCCTGTCATCAACAGCGAATGCTATTGACC
TGAGCGGAACCATCTTCGACAAAGCGGCGAAAGCATATAACCTCGACCCTCTTCTAGTGTATTCGGTCGC
ATTGGCCGAATCTGCATCAGGGAGAGGTAATGGCTCTATAAGTCCTTGGCCTTGGACGCTTCGCGTTCCT
GGGCTTCCTTTCTATGCCAAGTCGGAAGATCAGGCAAAGGCTAAGCTCGCAGAGTTTCAGCAGCAGTACG
GTCGTGCCATTGATGTCGGGTTCATGCAAGTGAGCATCCGCTGGAATGGTCATAGAGTTTCTTCTCCAGC
AGATCTTCTCGACCCTGAGACCAATGTCATGGTTGGGGCAGAGGTGCTATCAGAAGCCATTCAGTCATCT
CCAAATGACTTGGAGCTTGGCGTTGGCCGCTATCACGCCTGGGAAGACGAAATCCGAGCCAGAAACTATG
GTAGCCGAGTCTTGGCTATCTATCGCAACCTTCGTGATTTGTGA
 Primer design