SecReT4
Protein ID: 134044606
T4SS name [ID]Tra_F [587]
Gene symboltraF
Locus tagYR71pYR1_0175
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]146831..147859 [+]
Producttype IV conjugative transfer system protein TraF
Component typeTraF_F
UniProt IDA4IUK3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 4.7e-68, Aligned region: 43..272
Protein Sequence: 342 a.a.     [Download]
>gi|134044606|ref|YP_001101869.1| type IV conjugative transfer system protein TraF [Yersinia ruckeri]
MRETMKKSPLNLLLLAALTLGASHQAWAQDGTRPGFYERKEEGWFWYKEEPKEPEKKPEKPKPKPVAEAK
PTQPKPAAPLPSGPEMFSAEWFRENLPKYKDLAWNNPTVENVRTFLYLQRFAIDRSEQFSDATELAVVGD
PFLDEITRRPAATFASQQVDRDAGNAKNMLLKSVADRVGIFFFYKSDDDYSDLQAPLIKMLEQGEGFSII
PVSMDGKPLPSGLFPHYKTDEGHAKQLGIVTFPAVYLASPDGQFAPIGQGPMSLPELNHRILVAAKRNGW
VTDEEFNRTRPVLNLENNIAERLASPELGSDLKQLSQASGDKDNFVPPEQLMKYIRDKLQEN
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|134044452|ref|NC_009139.1|:146831-147859 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
GTGCGTGAGACTATGAAAAAATCACCTTTGAATTTACTGCTCCTTGCAGCGCTCACGCTGGGGGCATCAC
ACCAGGCTTGGGCTCAAGATGGCACACGGCCTGGTTTTTATGAGCGAAAGGAAGAGGGTTGGTTCTGGTA
CAAGGAAGAGCCCAAAGAACCAGAGAAAAAACCCGAAAAGCCCAAACCAAAGCCTGTGGCAGAAGCGAAG
CCTACACAGCCGAAGCCTGCTGCTCCGCTACCGAGCGGCCCAGAAATGTTCTCAGCGGAATGGTTCCGGG
AAAACTTACCCAAGTACAAAGACCTTGCTTGGAACAATCCTACCGTCGAAAACGTCAGGACATTTCTCTA
TTTGCAGCGATTTGCGATAGATCGCTCTGAACAGTTTTCAGATGCTACAGAGTTGGCGGTCGTAGGTGAT
CCTTTCTTGGATGAAATTACTCGACGTCCTGCTGCCACGTTTGCCTCACAACAGGTTGATCGTGACGCTG
GTAACGCCAAAAACATGCTACTCAAAAGCGTAGCCGACCGCGTAGGGATATTCTTCTTCTACAAGTCCGA
CGATGACTACAGTGACTTGCAAGCACCGCTCATCAAGATGTTGGAACAAGGAGAAGGATTCTCGATCATT
CCTGTATCTATGGACGGCAAACCACTCCCCAGTGGGCTTTTCCCCCATTACAAAACCGATGAAGGCCATG
CCAAACAACTTGGTATCGTAACTTTCCCTGCTGTTTACCTCGCATCTCCAGATGGTCAGTTCGCTCCTAT
AGGACAAGGGCCAATGTCTCTTCCTGAGCTGAATCACAGGATTTTGGTCGCAGCAAAACGCAATGGTTGG
GTCACAGACGAAGAGTTTAACCGTACACGTCCGGTACTCAACCTGGAAAACAACATAGCCGAACGCTTGG
CCTCACCAGAGCTGGGCTCTGACCTCAAACAGCTATCTCAAGCGAGCGGTGATAAAGACAACTTTGTGCC
ACCGGAACAACTCATGAAGTACATCCGGGACAAATTACAGGAGAACTAA
 Primer design