SecReT4
Protein ID: 134044613
T4SS name [ID]Tra_F [587]
Gene symboltraB
Locus tagYR71pYR1_0084
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]59997..61313 [+]
Producttype IV conjugative transfer system protein TraB
Component typeTraB_F
UniProt IDA4IUB2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.2e-50, Aligned region: 225..427
Protein Sequence: 438 a.a.     [Download]
>gi|134044613|ref|YP_001101778.1| type IV conjugative transfer system protein TraB [Yersinia ruckeri]
MIKRFWTQLDPNKKRWVSIAGGVFVLFAVVTMFSGEPKKEEKRGRQETIKHVLTDKNTREIGIDSLSADV
KMVSRENSDLKKELERVKKELEETKTTAGKSSDVGREMTRLRQDLDRLTQKNMELAKKVETGAAGGKTSS
SSEDARADVNGASGGDGQFMEKKLDYKDPASFFRDAPLPDSKGGAPATGKGDGRDATKPGIQIVSYSQKA
PEVEEKDNKDDESIYLPSGSILTGVLINGMDAPTSQGARRDPFPSTLRIQKEAILPNRFRADVRECFLIV
SGYGDLSSERAYLRGETFSCVRDDGGVIEAKLDSYAVGEDGKAGVRGRVVSKQGQIIAKSLMAGFLGGVS
EAFDVNPVPVVSTNPGSNTQYQSVFSDQMLQGAAVKGASKALDRIAQFYIDMAEGIFPVIEVDAGRQVDI
IVTKGTKLQIRSTGGTKK
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|134044452|ref|NC_009139.1|:59997-61313 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
ATGATTAAGCGATTTTGGACACAGTTAGACCCCAACAAGAAGCGTTGGGTGTCTATCGCTGGCGGCGTCT
TCGTTCTTTTTGCGGTCGTGACAATGTTCTCTGGTGAACCCAAGAAAGAAGAGAAGCGCGGTCGCCAAGA
AACCATCAAGCACGTTCTCACAGACAAAAACACCCGTGAGATCGGGATAGATTCGTTGTCTGCCGATGTG
AAGATGGTGTCTCGTGAAAACTCCGACCTGAAAAAGGAGCTGGAACGAGTCAAGAAAGAGCTGGAGGAAA
CCAAAACCACTGCCGGGAAATCCAGTGATGTTGGCCGTGAGATGACCCGCCTTCGTCAAGATTTGGACCG
CCTGACCCAGAAGAACATGGAATTGGCTAAGAAAGTCGAAACCGGCGCTGCTGGTGGAAAAACATCCTCT
TCATCAGAGGATGCCAGAGCCGATGTTAATGGTGCATCTGGTGGTGATGGTCAGTTCATGGAGAAAAAGC
TCGACTACAAAGATCCAGCATCCTTTTTTCGGGACGCACCGCTTCCTGACTCGAAGGGTGGGGCTCCTGC
AACTGGCAAGGGAGACGGTCGTGATGCAACTAAACCAGGCATCCAAATAGTGAGCTACTCGCAGAAAGCG
CCAGAAGTTGAAGAGAAGGACAACAAGGATGATGAGTCTATCTACCTACCTTCTGGCTCCATCCTGACAG
GGGTGCTCATCAACGGTATGGACGCACCAACATCTCAAGGTGCTCGTCGAGATCCGTTCCCTTCGACCCT
CAGGATTCAGAAAGAGGCTATTTTGCCTAACCGCTTCCGTGCGGATGTTCGTGAGTGCTTCCTGATTGTT
TCAGGCTATGGAGATCTCAGTTCAGAGCGAGCGTACCTGCGTGGCGAGACCTTCTCGTGCGTTCGGGATG
ATGGGGGGGTCATAGAAGCGAAGCTGGATTCCTATGCAGTGGGTGAAGACGGTAAGGCCGGTGTCCGTGG
TCGCGTCGTATCGAAGCAGGGGCAAATCATCGCCAAGAGCTTGATGGCAGGCTTCCTTGGTGGCGTTTCC
GAAGCCTTTGACGTCAATCCTGTGCCGGTCGTCAGCACTAACCCTGGCTCAAATACCCAGTACCAGTCTG
TGTTCTCCGACCAGATGTTGCAGGGAGCAGCAGTGAAGGGGGCCAGTAAGGCGCTAGATCGCATCGCTCA
GTTCTATATCGACATGGCCGAAGGCATCTTCCCCGTTATCGAGGTCGATGCTGGCCGTCAGGTAGACATC
ATCGTGACCAAAGGAACCAAGCTACAAATTCGTTCCACCGGGGGAACCAAGAAATGA
 Primer design