SecReT4
Protein ID: 134044619
T4SS name [ID]Tra_F [587]
Gene symboltraV
Locus tagYR71pYR1_0085
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]61310..61888 [+]
Producttype IV conjugative transfer system protein TraV
Component typeTraV_F
UniProt IDA4IUB3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 1.8e-26, Aligned region: 48..163
Protein Sequence: 192 a.a.     [Download]
>gi|134044619|ref|YP_001101779.1| type IV conjugative transfer system protein TraV [Yersinia ruckeri]
MKNLNILTRKGSSRGEAQKEQAVRSAKMLGVGAALLILSGCSTFNIGKDEYSCPGMPNGVQCMSARDVYA
ATNDGNVPRPMKPEEVEAKAEADGEGSSNVSANSSSSGDPVIDNYVAPRLPDRPIPIRTPAQVMRIWVAP
WEDTNGDLIVTGYVYTEIEPRRWVIGDGTPQSEPVLRPLQTVQHEPKSETTK
 
Nucleotide Sequence: 579 bp     [Download]
>gi|134044452|ref|NC_009139.1|:61310-61888 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
ATGAAAAATTTGAACATTTTGACCAGAAAGGGCAGTTCCAGAGGCGAGGCTCAAAAGGAACAGGCAGTAA
GATCCGCAAAGATGTTGGGGGTGGGTGCAGCGCTACTTATTTTGTCGGGCTGTTCGACGTTCAACATCGG
CAAGGATGAGTATAGCTGTCCGGGAATGCCGAATGGTGTTCAGTGTATGTCAGCGCGAGACGTTTACGCC
GCAACCAATGACGGAAATGTCCCGCGCCCAATGAAACCAGAGGAAGTCGAGGCCAAAGCGGAAGCGGATG
GCGAAGGTTCCTCAAACGTTTCAGCGAACTCATCTAGCTCCGGAGACCCGGTGATTGACAACTATGTCGC
ACCGCGTCTTCCGGATCGCCCGATTCCAATTCGTACACCAGCACAGGTTATGCGGATTTGGGTAGCTCCC
TGGGAGGACACCAATGGTGATCTCATCGTGACAGGGTATGTCTATACCGAAATCGAACCGCGCAGGTGGG
TGATTGGGGATGGCACACCGCAAAGTGAGCCAGTTTTGAGACCGCTGCAAACGGTACAACACGAACCGAA
GTCTGAAACAACCAAATAG
 Primer design