SecReT4
Protein ID: 134044622
T4SS name [ID]Tra_F [587]
Gene symboltraW
Locus tagYR71pYR1_0092
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]72138..73403 [+]
Producttype IV conjugative transfer system protein TraW
Component typeTraW_F
UniProt IDA4IUC0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.8e-26, Aligned region: 106..231
Protein Sequence: 421 a.a.     [Download]
>gi|134044622|ref|YP_001101786.1| type IV conjugative transfer system protein TraW [Yersinia ruckeri]
MIRSLAAHIPCSKSVLVALMFSVAGGAYAQESPLTEQDKALIEQGKQIAQKAQKMEMPSLLQNQHMDEAQ
AEAKAFFKQLQTTNPTLKEMHRKQAEKGIYSDHRILVFASLSLGEQGLDDVLTAVSGQPDSVIVFRGIPE
GMNLGQGVKAIQALAAKKDPVPNIIINPTLFKTYNITAVPTIVMLEDEPLPGEQPNVVAQVSGLSDPVWL
AREVDNGEKGDLGVKGPVEKISEPDLIDVAKKRLANIDWEEKKKQAIERFWTKQNFNELPRAPKSRTREI
DPSVMITSDISTPDGTVFAHAGDVINPLCDPKEVCKPGTRPFTQAVVVFDPLDKKQMELLAKKLPEIKQE
PGVQRITYIATEFDKDKGWDSYKSVTDNFDAPVYLLTPDLITRFELEHTPSVITARGKKFVVRELAEEGG
E
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|134044452|ref|NC_009139.1|:72138-73403 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
ATGATCAGATCATTGGCCGCGCATATCCCCTGTTCTAAGAGCGTTCTGGTGGCGTTGATGTTCTCTGTGG
CTGGCGGGGCATACGCTCAAGAGTCTCCGCTCACAGAGCAGGATAAGGCGCTTATTGAGCAAGGAAAGCA
AATTGCCCAAAAGGCCCAGAAGATGGAAATGCCATCTCTGTTGCAAAACCAACACATGGACGAGGCTCAG
GCCGAAGCCAAGGCATTTTTCAAGCAGCTCCAAACTACTAACCCAACGCTCAAGGAGATGCACCGGAAAC
AGGCTGAAAAGGGTATCTACTCTGACCATCGGATACTGGTTTTCGCCTCGTTGTCTCTTGGCGAACAGGG
GTTAGATGACGTCCTAACGGCGGTGTCAGGCCAGCCTGATTCTGTAATTGTGTTCCGTGGCATCCCGGAA
GGAATGAACTTGGGGCAGGGAGTTAAAGCTATTCAGGCGCTCGCGGCCAAAAAAGACCCAGTGCCGAACA
TCATCATCAACCCTACGTTGTTCAAAACGTACAACATCACAGCCGTTCCCACGATTGTGATGCTGGAGGA
TGAGCCGCTGCCTGGCGAACAACCAAACGTCGTCGCCCAGGTCTCCGGGTTGTCCGACCCGGTATGGTTG
GCTCGGGAAGTGGATAACGGAGAAAAAGGCGATCTCGGCGTTAAGGGGCCGGTGGAGAAAATCAGTGAGC
CAGACCTTATTGATGTTGCCAAGAAACGCCTTGCCAATATCGACTGGGAAGAGAAGAAGAAACAGGCTAT
AGAGCGCTTCTGGACCAAGCAGAATTTCAATGAGCTGCCCAGAGCGCCAAAATCTCGAACACGAGAAATT
GACCCTAGCGTCATGATCACCAGTGACATCAGCACTCCGGATGGCACTGTGTTCGCTCACGCGGGTGACG
TGATCAACCCATTGTGCGATCCGAAGGAAGTTTGCAAGCCTGGAACGCGGCCATTTACCCAAGCGGTCGT
AGTTTTCGACCCGCTGGACAAAAAGCAAATGGAGCTGCTCGCCAAGAAGCTGCCTGAAATTAAGCAGGAA
CCTGGCGTACAACGGATTACCTATATCGCCACAGAGTTCGACAAAGACAAAGGCTGGGATTCCTACAAGA
GTGTCACCGACAACTTTGACGCGCCGGTATATCTGCTGACGCCAGATCTGATTACCCGGTTCGAGCTGGA
GCACACACCGAGCGTCATTACTGCCAGAGGCAAGAAGTTTGTTGTCCGCGAACTTGCTGAGGAGGGCGGT
GAATGA
 Primer design