SecReT4
Protein ID: 134044633
T4SS name [ID]Tra_F [587]
Gene symboltraU
Locus tagYR71pYR1_0094
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]74068..75075 [+]
Producttype IV conjugative transfer system protein TraU
Component typeTraU_F
UniProt IDA4IUC2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 6.6e-70, Aligned region: 37..334
Protein Sequence: 335 a.a.     [Download]
>gi|134044633|ref|YP_001101788.1| type IV conjugative transfer system protein TraU [Yersinia ruckeri]
MMQKILRVIAVSAVFWVRSVSADPGCQNAEVIGGKLITDICWSCIFPIKVAGVPISGGGGSFPSEAVSNP
LCMCEDNLGVPRPGVTTSMWEPARLVEFQRVPGCSSVLNGVRFPFDRTNQGHHGMGDMDGGDGSFMHYHY
YAFPLLVMLDLFIKQTCNADGYMDLDIMYMSELDPTWNNDELAFFTNPEAAAVANPIAAAACTADAVSST
AGKPLKQLFWCAGSWGTLYPFSGNQNGGKGVIRDSSLLSTRVLAALHRRGLAWKTMGSEAMCRGVISPTL
PKTQYKFTLLHPVPETNSSHVIGESTLTWGLARTIPAIGQDPIYTIWRWNDCCNN
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|134044452|ref|NC_009139.1|:74068-75075 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
ATGATGCAAAAAATTCTACGGGTCATTGCCGTTAGCGCGGTCTTTTGGGTTCGTTCGGTATCGGCTGACC
CTGGGTGCCAGAATGCGGAAGTAATCGGCGGAAAACTGATTACTGACATCTGCTGGAGCTGTATTTTTCC
CATCAAAGTAGCAGGGGTTCCTATAAGTGGTGGAGGCGGATCATTCCCGAGTGAAGCCGTAAGCAACCCT
CTGTGTATGTGCGAGGATAATCTAGGGGTCCCTCGGCCTGGAGTCACCACTTCTATGTGGGAGCCAGCAC
GGCTTGTTGAATTTCAGAGAGTGCCTGGCTGCTCATCTGTCTTGAATGGTGTCAGGTTCCCGTTTGATAG
GACTAACCAAGGGCATCATGGCATGGGAGACATGGATGGTGGTGATGGTTCTTTTATGCACTATCACTAC
TATGCGTTTCCTCTGTTGGTGATGCTCGATTTATTTATTAAGCAGACCTGTAATGCTGATGGGTATATGG
ATCTCGACATCATGTACATGTCGGAGCTCGACCCGACCTGGAACAATGATGAGCTCGCTTTTTTTACCAA
TCCAGAGGCGGCGGCAGTAGCAAACCCAATTGCGGCGGCTGCGTGTACTGCTGATGCTGTCTCATCAACC
GCTGGAAAACCTTTAAAACAGCTTTTCTGGTGTGCTGGTTCATGGGGCACCCTGTATCCATTTAGTGGCA
ACCAGAATGGTGGAAAAGGTGTTATCCGCGATAGCAGTCTTCTTAGCACAAGGGTTCTGGCTGCTTTGCA
TCGCCGGGGGTTAGCGTGGAAGACAATGGGTTCTGAGGCTATGTGTAGAGGTGTTATTAGCCCAACACTA
CCCAAAACGCAGTACAAATTCACGCTATTGCATCCGGTTCCAGAGACAAACTCATCTCACGTAATTGGCG
AATCCACTCTTACGTGGGGTCTGGCGCGAACTATACCGGCAATTGGGCAAGACCCTATTTACACCATCTG
GCGATGGAATGATTGCTGTAACAATTGA
 Primer design