SecReT4
Protein ID: 134044634
T4SS name [ID]Tra_F [587]
Gene symbol-
Locus tagYR71pYR1_0083
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]59185..60000 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDA4IUB1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 3.7e-22, Aligned region: 28..249
Protein Sequence: 271 a.a.     [Download]
>gi|134044634|ref|YP_001101777.1| hypothetical protein YR71pYR1_0083 [Yersinia ruckeri]
MKKDVPAPVTSGQSSHEVVGSMNENPLLTMKPGVNQIIPIAVGHPNRIVTPFSNPEIVSTSLTGATDNGQ
CGEVCIKENVVYVATDKQYPVTMFITEKGSEAQALSLTMVPRRIPPREVFLKLDGGVGITGAFANTKAET
WEQSQPYVETIRSVFRKIALGEVPQGYTLNRIPAGAAVPSCAHPGVKVDFSKGQYMMGHHLNVFIGVALN
VSDQPIEFKEALCGSWDVAAVTTWPLNVLEPGQKTEIYVAKKQKRGLAPTSKRPSLLGGAQ
 
Nucleotide Sequence: 816 bp     [Download]
>gi|134044452|ref|NC_009139.1|:59185-60000 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
ATGAAAAAGGATGTTCCTGCCCCTGTGACGTCAGGACAAAGCTCCCATGAGGTTGTGGGCAGCATGAATG
AAAACCCCTTACTGACGATGAAGCCGGGGGTTAACCAGATCATCCCGATAGCCGTTGGTCATCCGAACCG
AATCGTCACGCCTTTCAGCAATCCTGAGATCGTTTCAACATCTCTGACCGGGGCGACGGATAACGGCCAG
TGTGGTGAGGTCTGCATCAAAGAGAATGTGGTCTATGTCGCCACGGATAAGCAGTATCCGGTGACTATGT
TCATTACTGAAAAAGGCTCGGAAGCCCAAGCTCTCAGCCTGACGATGGTTCCCCGTCGTATTCCGCCCAG
AGAAGTCTTTCTCAAGCTCGATGGTGGTGTAGGTATCACTGGTGCTTTTGCCAATACCAAGGCTGAGACC
TGGGAACAGAGCCAGCCTTATGTCGAAACCATCCGGTCAGTATTCCGAAAGATTGCTCTTGGTGAAGTCC
CTCAAGGTTACACGTTGAACCGCATCCCTGCTGGTGCTGCGGTGCCGAGCTGCGCTCATCCTGGGGTAAA
GGTGGATTTTAGCAAGGGGCAATACATGATGGGCCACCACCTTAACGTGTTCATCGGTGTCGCCCTGAAC
GTCTCTGATCAGCCTATTGAGTTCAAAGAGGCGTTGTGTGGGAGCTGGGATGTGGCTGCGGTGACTACGT
GGCCGCTTAACGTGCTTGAGCCCGGCCAGAAGACGGAGATCTATGTGGCGAAGAAGCAGAAGCGTGGTCT
CGCACCAACGTCTAAGCGTCCATCGCTGCTGGGAGGTGCCCAATGA
 Primer design