SecReT4
Protein ID: 134044637
T4SS name [ID]Tra_F [587]
Gene symboltraL
Locus tagYR71pYR1_0081
StrainYersinia ruckeri plasmid pYR1 (NC_009139)
Repliconplasmid pYR1 [GenBank: NC_009139] [Browse all T4SS(s) in this replicon]
Location [Strand]58195..58476 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDA4IUA9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.4e-15, Aligned region: 4..80
Protein Sequence: 93 a.a.     [Download]
>gi|134044637|ref|YP_001101775.1| type IV conjugative transfer system protein TraL [Yersinia ruckeri]
MKPVKIPRRVDEPPHLLLWSADELAPMLLGLTIGVIIGKALICFLGGLLVTNLYRRFRDNHPDGYLLHMI
YWAGFIMTKAKSLKNPFVRRYLP
 
Nucleotide Sequence: 282 bp     [Download]
>gi|134044452|ref|NC_009139.1|:58195-58476 Yersinia ruckeri YR71 plasmid pYR1, complete sequence
ATGAAGCCTGTAAAGATACCGCGCCGGGTCGATGAGCCCCCGCATCTGCTGTTGTGGAGCGCAGATGAGT
TGGCCCCGATGCTTTTGGGGCTAACGATAGGGGTCATCATCGGTAAGGCCCTGATCTGCTTTCTGGGGGG
GTTACTTGTAACCAACCTTTATCGCCGATTCAGGGATAACCATCCGGATGGATACCTGCTCCACATGATC
TACTGGGCCGGGTTCATCATGACCAAGGCCAAATCTCTCAAGAATCCGTTTGTCCGGAGGTATTTGCCTT
GA
 Primer design