SecReT4
Protein ID: 134044751
T4SS name [ID]Tra_F [585]
Gene symboltraG
Locus tagYpIP275_pIP1202_0213
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]174261..177875 [+]
Producttype IV conjugative transfer system protein TraG
Component typeTraG_F
UniProt IDA4IV67
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.6e-104, Aligned region: 5..469
Protein Sequence: 1204 a.a.     [Download]
>gi|134044751|ref|YP_001102273.1| type IV conjugative transfer system protein TraG [Yersinia pestis biovar Orientalis str. IP275]
MGSFSIHSIGDSAFLEQILIAVSMITGTGDFEKMVSIGLLLGVLMICIQSVFQGAKQINLQQVLVGWILY
ACFFGPTTTVTIEDAYTGQVRVVANVPIGVGFAGGVISNVGYTITNLFETGYGVIVPNVTESHFSETLKL
LNDVRRRAYDTGVFTALNSANGGGYVDVRRSWNNYIRECTLTKVDLNLMSLDELMNRSTDSALRFNSQLY
GTRLYLSTANPDGADYTCTDGWVAISTATANLSSPVVVDALNSLLGIDTSTGDNALTKLTDSLQAMGATT
TSSIDYLKAAVLEPLYYEAAAGRYQDLQDYGSALMVNQAIQQRNTQWAAEQSMFMTVVRPMLTFFEGFIY
AITPIIAFIIVMGSFGLQLAGKYVQTILWIQLWMPVLSIINLFVHTAASNEMSSLSAGGLNSMYALSSTG
DVLQHWIATGGMLAAATPVISLFIVTGSTYAFTSLASRISGSDHVDEKMQTPDLLKQGPVMQSQPAYNHN
QFSGAIANGAESMISTFSLGSTLASGVSSAQALQSQKSEAFQSTLGRGFSDGVSQDQAYSRLSNVGRNVS
SQNTAQSQLINQQAKNFMDKFQVDDSHSDAVKGAFAMQAMGTLDVDEAASMLMPMVGKARAAMKAAAGVK
SNSTALVPAGGNGESGGGSDVLDIKAQAKGATESSTQDSSSWSASDVSQFMKGVSYSQTDSQALTNQLAQ
GFSRSGSESFKQTWGDSLSQNLSKSASELVSASDTFTTMSQLQNQMGSMTNTDFKTLGGAVAQTPAAMNQ
LNDYFRNAAPQSVKDEAASLQQRYQAYGMSPQVAQAAARMTAMTNSKNYEQGKELGGYQAALQAINTASG
RNGAFSGDAYGNNGIEGPNVQGLPGQVQGAVGSGPNIPTGFRENVAGMAGTNPASEAGQLPTNSPLVQNE
HAAGTSALHNQAQQTERNVSAPELKKAQDNLMNSLPEMSWSASAWGAWDNSSDWMGRRAEQAGGALIAGG
QAGADAFSRAMDQMRTMTPEQRDQFIAATQRGDQAVQEEFGWAGDAMVGMAKLGRNVMGAAASGYDAAKE
WLTGKSDLSEAAKGMSIEERGAFYAAALSSAAEAGGGAAQQFMNQYGDEFKETMQSIAQSRYGLTESQAA
VYAESFDTNEGRMNQAVQNLKMEYAERNPDGSPMMQGGQPVLSQQNEEFTDKLVNVLQNSTEAGDRSGSY
LTAVRGYNIANQRF
 
Nucleotide Sequence: 3615 bp     [Download]
>gi|134044743|ref|NC_009141.1|:174261-177875 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGGGATCTTTTTCAATCCACTCTATCGGTGACTCTGCTTTTCTGGAGCAAATCCTGATTGCAGTATCAA
TGATCACCGGCACCGGGGATTTCGAGAAGATGGTCAGTATTGGCCTGCTTCTTGGGGTCTTGATGATCTG
TATTCAGTCCGTCTTTCAGGGCGCAAAGCAAATCAACCTCCAGCAAGTGCTGGTAGGTTGGATTCTATAT
GCCTGTTTCTTCGGCCCAACCACAACTGTGACTATCGAGGACGCTTATACAGGGCAGGTTCGAGTCGTCG
CCAATGTCCCTATTGGGGTAGGCTTTGCTGGAGGTGTCATATCCAACGTGGGATACACCATCACCAATTT
GTTTGAAACTGGATATGGGGTAATCGTACCCAATGTCACGGAAAGCCACTTTTCCGAAACACTGAAACTG
TTGAATGACGTCAGACGGCGAGCCTATGACACAGGAGTTTTTACTGCGCTTAACTCAGCAAATGGAGGCG
GCTATGTTGACGTGAGGCGTTCCTGGAACAATTACATTCGGGAATGCACGTTAACCAAAGTCGATCTCAA
CCTAATGTCCCTTGATGAGTTGATGAACCGTTCAACTGACTCAGCTTTGCGATTCAACTCACAGCTCTAC
GGAACTAGGTTGTATTTGTCTACAGCAAACCCTGACGGCGCTGACTACACATGTACTGACGGATGGGTGG
CTATTAGCACTGCAACCGCCAACCTAAGCAGCCCGGTTGTTGTTGATGCTCTTAACAGCCTACTGGGTAT
TGACACGTCAACTGGAGACAACGCTCTAACGAAGCTGACCGATTCGCTTCAAGCGATGGGTGCCACAACT
ACGTCATCAATCGACTATCTGAAAGCCGCCGTTCTGGAGCCCCTCTATTATGAAGCCGCAGCAGGACGTT
ATCAGGACCTCCAGGATTATGGCTCTGCATTGATGGTCAACCAGGCTATTCAGCAACGGAACACACAGTG
GGCCGCAGAGCAGTCGATGTTCATGACCGTCGTCCGACCAATGCTGACGTTCTTTGAAGGCTTTATTTAT
GCTATAACCCCGATCATTGCTTTTATTATCGTGATGGGCAGCTTCGGCCTCCAGTTAGCCGGGAAATATG
TACAAACCATCCTCTGGATTCAGCTATGGATGCCAGTCCTCTCAATTATAAACCTGTTTGTTCATACCGC
CGCGTCAAATGAGATGTCTAGCCTCAGTGCTGGTGGTCTCAACTCCATGTACGCTCTTTCCTCAACTGGA
GATGTTCTGCAACACTGGATTGCAACCGGCGGCATGTTGGCTGCGGCCACTCCGGTGATTTCCCTGTTTA
TCGTCACAGGTAGCACCTACGCCTTCACCAGCTTGGCATCGAGAATAAGTGGTTCTGACCACGTTGACGA
AAAGATGCAAACGCCAGATCTACTCAAGCAAGGTCCGGTTATGCAAAGTCAGCCAGCGTACAATCACAAC
CAGTTCAGTGGTGCGATTGCAAACGGCGCAGAAAGCATGATCAGTACCTTCTCGCTTGGCTCCACCTTGG
CATCAGGCGTGAGCTCCGCACAGGCATTACAAAGTCAGAAATCGGAGGCTTTCCAAAGCACTCTTGGTCG
AGGTTTTTCTGATGGAGTAAGTCAGGATCAAGCCTATTCAAGACTCTCCAATGTCGGGCGCAACGTTTCG
TCGCAAAACACAGCTCAAAGCCAATTGATCAACCAGCAAGCCAAGAACTTCATGGATAAGTTCCAGGTGG
ATGATAGCCACTCTGATGCTGTCAAAGGTGCTTTTGCCATGCAGGCTATGGGCACACTCGATGTTGACGA
AGCTGCGTCCATGCTTATGCCTATGGTTGGCAAGGCCAGGGCAGCAATGAAGGCCGCTGCTGGTGTGAAA
TCAAACAGTACAGCCCTAGTTCCTGCTGGTGGTAATGGCGAATCAGGCGGCGGCAGTGATGTCCTGGACA
TCAAAGCGCAAGCGAAGGGAGCAACAGAGTCATCAACTCAAGACTCTTCAAGCTGGTCAGCGAGTGATGT
GTCCCAGTTCATGAAGGGTGTGAGCTATTCGCAAACCGATAGCCAGGCGTTGACAAATCAATTAGCGCAG
GGTTTCAGCCGTTCTGGAAGCGAGTCATTCAAGCAAACCTGGGGCGATAGCTTATCCCAGAACCTATCCA
AGTCCGCTTCTGAACTGGTGTCTGCATCGGACACCTTCACAACAATGAGTCAGCTCCAAAACCAAATGGG
CTCCATGACTAATACCGACTTTAAAACTCTCGGTGGTGCAGTAGCACAAACCCCTGCGGCCATGAACCAA
CTGAATGACTATTTCCGAAATGCCGCGCCGCAATCGGTTAAAGACGAGGCGGCTTCACTACAGCAAAGAT
ACCAAGCCTACGGAATGTCTCCTCAAGTGGCCCAGGCAGCAGCGCGAATGACAGCAATGACCAACTCCAA
AAATTACGAACAGGGTAAGGAGCTTGGCGGGTATCAAGCCGCACTACAGGCGATCAATACCGCGTCCGGT
CGCAACGGAGCATTTAGTGGTGATGCTTACGGAAATAACGGCATTGAAGGCCCGAATGTTCAAGGCCTAC
CAGGTCAGGTTCAAGGGGCTGTAGGCAGTGGACCTAACATCCCAACCGGATTCCGGGAGAATGTGGCTGG
GATGGCTGGAACTAATCCGGCATCAGAAGCTGGGCAGTTACCAACGAATAGCCCCCTTGTTCAAAATGAA
CATGCAGCCGGTACGTCAGCTCTTCATAACCAAGCACAGCAAACAGAGCGAAATGTATCTGCTCCTGAAC
TGAAAAAAGCCCAAGATAACCTTATGAACTCGCTTCCGGAAATGTCTTGGAGCGCTTCGGCGTGGGGAGC
GTGGGACAACTCCAGTGATTGGATGGGCCGCAGAGCTGAACAAGCAGGTGGAGCTCTCATTGCTGGTGGT
CAAGCTGGCGCTGATGCGTTCTCAAGAGCGATGGATCAAATGAGAACGATGACACCTGAACAACGCGACC
AATTCATCGCGGCCACTCAACGCGGCGACCAGGCCGTGCAAGAGGAGTTTGGCTGGGCCGGTGATGCGAT
GGTCGGTATGGCTAAACTTGGCCGCAACGTCATGGGAGCTGCTGCAAGCGGCTATGATGCAGCGAAGGAG
TGGTTAACTGGTAAATCTGATCTATCGGAAGCCGCTAAAGGGATGAGCATTGAGGAACGCGGCGCGTTCT
ATGCAGCAGCGCTATCCTCTGCCGCAGAAGCTGGTGGTGGAGCCGCGCAGCAGTTTATGAACCAGTACGG
TGATGAGTTCAAAGAAACGATGCAGTCTATCGCTCAAAGCCGTTATGGGCTGACTGAATCCCAAGCCGCT
GTTTATGCCGAATCGTTTGACACAAACGAAGGTCGCATGAACCAGGCTGTTCAGAATCTGAAAATGGAGT
ATGCAGAACGTAACCCGGATGGCTCACCGATGATGCAAGGAGGTCAGCCTGTTCTTTCTCAGCAAAACGA
AGAGTTTACGGACAAGCTGGTAAACGTATTGCAGAACTCGACGGAAGCTGGAGACCGTTCAGGTAGCTAT
TTGACTGCCGTCAGGGGGTACAACATAGCAAATCAAAGGTTCTAA
 Primer design