SecReT4
Protein ID: 134044766
T4SS name [ID]Tra_F [585]
Gene symboltraN
Locus tagYpIP275_pIP1202_0115
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]89594..92392 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDA4IUX3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 2.6e-56, Aligned region: 424..681
TraN [PF06986], Evalue: 2.6e-56, Aligned region: 766..841
Protein Sequence: 932 a.a.     [Download]
>gi|134044766|ref|YP_001102179.1| conjugal transfer mating pair stabilization protein TraN [Yersinia pestis biovar Orientalis str. IP275]
MRSHNYFMKAVASLLTVTMSALPIHSYANGSQDQDITAVGKEAQAFGQNLSNSFKSSSGTVQDGTISMPT
LKDGQFQMNGGSQINVNDLFPGTSGTNNKPDSYYFPDANKPDVGGLQGIYDSGDDMDSVGNNAKGSLWSD
ANSANPSISGAAYKVLLDASNRSRPDFSNDPVLNLSKKTYEDMDLIAGGFGDCSAETTINQNTINAHIPE
YERCQRVVDQSADCEVVHDYDASVVKHYDGPYNLKSCGEGCTELWIGRVGNDYWSGNCSIYEEYTRVQVS
NPDAIVSATLEYAKWDDYMQVWVGKSGQETKVWSGPDGNFPPETAGRCELSTSWERNPNIDVTPYFKNVK
DGDVVTFKIRVSVTGAGEGFGRIKLRYDPSKAITKDEWAPQSCMDSAKGVVDGFAEGEITCIDDPTDATG
CTVINGIKVCESQLKPSPLPGIPKLCKKVRVKADYDFYKGQMDCWTDPQGETHCPVNTGGNLDSCQKYEE
NPQCGFISSKCVDGAQGSSGTCYVHEDTYDCGTDVSVPTLEKETEYQCGGPIRCMGDDCLDLTKTQSTDF
ARATALLNAAQFMTQDMSCTGQDGDDNPTGDENVICSAFAGEAGECKIAVGGVSDCCEKPTNISLADYLN
LIMAVPKLDGAVMGLTDGNALKGAYQVLREPALQGWTEVTKPFTSYIENVSGAVDSFFQPVEQFVDQLID
QLKEQVKEVMMDVMKSAGQDAATEQAAAAASEQAAEAMMETATTWLSTAMTIYTVYVVAMVMIQMIYKCE
EEEFTMNAKRALKNCTYVGSYCKSKVLGACIEKREAYCCFNSPLSRIIQEQVRPQLGQNFGDPKNPQCEG
IPLDKIAEIDWSKINLDEWLGILQQNGKFPDPASINLDSLTGAGNDFNIDGTRKNAQERALERLEGIDID
AKRKEATNSIDPQTGAPTGGGG
 
Nucleotide Sequence: 2799 bp     [Download]
>gi|134044743|ref|NC_009141.1|:89594-92392 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGCGAAGTCATAATTACTTTATGAAAGCTGTGGCCTCGCTGTTGACAGTAACCATGTCTGCGCTGCCGA
TACATTCCTACGCTAACGGTAGCCAAGACCAGGACATCACAGCGGTGGGTAAAGAGGCCCAGGCTTTCGG
ACAAAACCTCTCAAACTCATTCAAGTCGAGCTCGGGGACTGTGCAAGATGGCACAATCTCTATGCCGACG
TTGAAAGACGGTCAATTCCAAATGAACGGGGGGAGTCAGATTAATGTCAATGATCTATTCCCCGGAACGA
GCGGGACCAACAATAAACCTGATAGTTATTACTTCCCTGATGCCAATAAACCTGATGTGGGCGGTCTGCA
AGGCATTTACGACTCTGGCGATGACATGGACAGCGTGGGGAATAATGCAAAAGGGTCGCTGTGGAGTGAT
GCCAATAGTGCTAATCCATCAATCTCTGGTGCGGCATACAAGGTTCTTCTCGATGCCTCTAATCGATCAC
GCCCTGATTTCAGTAATGACCCTGTACTAAATCTAAGCAAAAAGACCTATGAGGATATGGACCTCATCGC
AGGTGGCTTTGGGGATTGTTCTGCCGAAACAACCATCAATCAGAATACTATCAACGCCCACATTCCAGAG
TATGAACGGTGTCAGCGTGTTGTAGATCAAAGCGCGGACTGTGAGGTTGTCCATGACTACGATGCCTCTG
TGGTGAAGCACTATGATGGTCCATATAACCTCAAATCTTGTGGAGAAGGCTGTACTGAGTTGTGGATTGG
CCGAGTTGGTAACGACTACTGGAGTGGCAACTGTTCGATTTATGAGGAATACACGCGGGTCCAAGTCAGT
AATCCAGACGCCATAGTGTCTGCAACTCTTGAGTACGCCAAGTGGGATGACTACATGCAAGTTTGGGTTG
GTAAATCAGGTCAGGAAACTAAAGTATGGTCCGGCCCTGACGGCAATTTCCCTCCAGAAACGGCTGGCCG
ATGTGAATTGTCAACAAGTTGGGAGCGAAACCCTAATATTGATGTCACTCCCTATTTCAAGAATGTGAAA
GATGGTGATGTTGTTACGTTTAAGATCCGCGTTTCAGTAACTGGCGCAGGTGAGGGTTTTGGCCGCATAA
AGCTACGCTATGACCCATCAAAAGCCATTACCAAGGATGAGTGGGCTCCACAGAGCTGCATGGATTCAGC
CAAAGGGGTTGTAGATGGTTTTGCGGAAGGCGAGATCACATGTATAGATGACCCGACTGATGCTACGGGC
TGCACAGTCATCAATGGGATCAAAGTTTGCGAATCTCAACTCAAGCCGTCACCTTTGCCTGGTATTCCAA
AACTATGCAAAAAGGTTCGAGTTAAAGCTGACTATGACTTTTATAAGGGGCAAATGGACTGCTGGACAGA
CCCTCAAGGTGAAACGCACTGTCCGGTAAACACGGGCGGGAATCTCGATAGCTGTCAGAAATATGAAGAA
AACCCTCAGTGCGGCTTCATCAGTTCCAAATGTGTTGATGGTGCTCAGGGAAGTTCTGGTACGTGCTACG
TCCACGAGGATACTTATGACTGTGGTACAGATGTTTCTGTTCCGACCTTGGAAAAGGAAACTGAGTACCA
GTGCGGTGGGCCTATACGCTGCATGGGAGATGACTGCCTTGATTTGACCAAAACACAAAGCACTGATTTT
GCTCGCGCTACTGCGTTGCTCAATGCAGCCCAATTCATGACGCAGGATATGAGCTGCACAGGCCAAGATG
GGGATGACAATCCTACCGGGGATGAAAACGTTATTTGCTCTGCTTTTGCAGGGGAAGCTGGCGAATGCAA
GATAGCTGTTGGGGGAGTTTCTGATTGCTGTGAAAAGCCAACCAATATATCTCTTGCCGATTATCTGAAC
CTAATAATGGCCGTTCCAAAGCTCGATGGCGCAGTGATGGGGCTGACTGATGGTAATGCGCTTAAAGGTG
CTTATCAGGTACTTAGGGAACCTGCCCTTCAAGGGTGGACAGAAGTCACAAAACCGTTCACAAGTTATAT
AGAGAACGTTTCAGGTGCTGTTGATTCGTTCTTCCAGCCTGTAGAGCAGTTTGTTGATCAACTCATTGAC
CAGCTCAAAGAGCAAGTCAAAGAAGTGATGATGGATGTCATGAAATCAGCAGGCCAAGATGCAGCAACAG
AGCAGGCGGCTGCCGCAGCATCTGAACAAGCTGCCGAAGCAATGATGGAGACTGCGACAACATGGCTTAG
CACTGCCATGACGATATATACCGTCTATGTCGTTGCGATGGTGATGATCCAGATGATTTATAAGTGCGAG
GAAGAAGAGTTCACTATGAACGCCAAAAGAGCGCTCAAGAATTGCACCTATGTAGGCTCTTATTGTAAAT
CTAAGGTGTTGGGCGCTTGTATTGAAAAAAGAGAAGCGTATTGCTGCTTCAATTCTCCGCTCTCTCGTAT
TATACAAGAACAGGTTCGCCCTCAATTGGGGCAGAACTTTGGAGACCCCAAAAATCCTCAGTGTGAAGGG
ATTCCACTAGATAAAATTGCCGAAATTGATTGGAGCAAAATTAATTTGGATGAGTGGCTTGGGATATTAC
AGCAGAACGGTAAATTCCCTGATCCGGCCTCAATAAATCTCGACTCGCTGACTGGAGCAGGGAATGACTT
CAATATTGACGGGACGCGGAAGAATGCTCAGGAAAGGGCGTTGGAGCGGTTGGAAGGGATTGATATTGAC
GCGAAGCGAAAAGAGGCGACAAACAGCATAGACCCTCAAACAGGCGCGCCAACTGGTGGTGGTGGATAA
 Primer design