SecReT4
Protein ID: 134044768
T4SS name [ID]Tra_F [585]
Gene symboltraW
Locus tagYpIP275_pIP1202_0112
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]86541..87806 [+]
Producttype IV conjugative transfer system protein TraW
Component typeTraW_F
UniProt IDA4IUX0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1.8e-26, Aligned region: 106..231
Protein Sequence: 421 a.a.     [Download]
>gi|134044768|ref|YP_001102176.1| type IV conjugative transfer system protein TraW [Yersinia pestis biovar Orientalis str. IP275]
MIRSLAAHIPCSKSVLVALIFSVAGGAYAQESPLTEQDKALIEKGKQIAQKAQKMEMPSLLQNQHMDEAQ
AEAKAFFKQLQTTNPTLKEMHRKQAEKGIYSDHRILVFASLSLGEQGLDDVLTAVSGQPDSVIVFRGIPE
GMNLGQGVKAIQALAAKKDPVPNIIINPTLFKTYNITAVPTIVMLEDEPLPGEQPNVVAQVSGLSDPVWL
AREVDNGEKGDLGVKGPVEKISEPDLIDVAKKRLANIDWEEKKKQAIERFWTKQNFNELPRAPKSRTREI
DPSVMITSDISTPDGTVFAHAGDVINPLCDPKEVCKPGTRPFTQAVVVFDPLDKKQMELLAKKLPEIKQE
PGVQRITYIATEFDKDKGWDSYKSVTDNFDAPVYLLTPDLITRFELEHTPSVITARGKKFVVRELAEEGG
E
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|134044743|ref|NC_009141.1|:86541-87806 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGATCAGATCATTGGCCGCGCATATCCCCTGTTCTAAGAGCGTTCTGGTGGCGTTGATATTCTCTGTGG
CTGGCGGGGCATACGCTCAAGAGTCTCCGCTCACAGAGCAGGATAAGGCGCTTATTGAGAAAGGAAAGCA
AATTGCCCAAAAGGCCCAGAAGATGGAAATGCCATCTCTGTTGCAAAACCAACACATGGACGAGGCTCAG
GCCGAAGCCAAGGCATTTTTCAAGCAGCTCCAAACTACTAACCCAACGCTCAAGGAGATGCACCGGAAAC
AGGCTGAAAAGGGTATCTACTCTGACCATCGGATACTGGTTTTCGCCTCGTTGTCTCTTGGCGAACAGGG
GTTAGATGACGTCCTAACGGCGGTGTCAGGCCAGCCTGATTCTGTAATTGTGTTCCGTGGCATCCCGGAA
GGAATGAACTTGGGGCAGGGAGTTAAAGCTATTCAGGCGCTCGCGGCCAAAAAAGACCCAGTGCCGAACA
TCATCATCAACCCTACGTTGTTCAAAACGTACAACATCACAGCCGTTCCCACGATTGTGATGCTGGAGGA
TGAGCCGCTGCCTGGCGAACAACCAAACGTCGTCGCCCAGGTCTCCGGGTTGTCCGACCCGGTATGGTTG
GCTCGGGAAGTGGATAACGGAGAAAAAGGCGATCTCGGCGTTAAGGGGCCGGTGGAGAAAATCAGTGAGC
CAGACCTTATTGATGTTGCCAAGAAACGCCTTGCCAATATCGACTGGGAAGAGAAGAAGAAACAGGCTAT
AGAGCGCTTCTGGACCAAGCAGAATTTCAATGAGCTGCCCAGAGCGCCAAAATCTCGAACACGAGAAATT
GACCCTAGCGTCATGATCACCAGTGACATCAGCACTCCGGATGGCACTGTGTTCGCTCACGCGGGTGACG
TGATCAACCCATTGTGCGATCCGAAGGAAGTTTGCAAGCCTGGAACGCGGCCATTTACCCAAGCGGTCGT
AGTTTTCGACCCGCTGGACAAAAAGCAAATGGAGCTGCTCGCCAAGAAGCTGCCTGAAATTAAGCAGGAA
CCTGGCGTACAACGGATTACCTATATCGCCACAGAGTTCGACAAAGACAAAGGCTGGGATTCCTACAAGA
GTGTCACCGACAACTTTGACGCGCCGGTATATCTGCTGACGCCAGATCTGATTACCCGGTTCGAGCTGGA
GCACACACCGAGCGTCATTACTGCCAGAGGCAAGAAGTTTGTTGTCCGCGAACTTGCTGAGGAGGGCGGT
GAATGA
 Primer design