SecReT4
Protein ID: 134044796
T4SS name [ID]Tra_F [585]
Gene symboltraV
Locus tagYpIP275_pIP1202_0105
StrainYersinia pestis biovar Orientalis str. IP275 plasmid pIP1202 (NC_009141)
Repliconplasmid pIP1202 [GenBank: NC_009141] [Browse all T4SS(s) in this replicon]
Location [Strand]75713..76291 [+]
Producttype IV conjugative transfer system protein TraV
Component typeTraV_F
UniProt IDA4IUW3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 1.8e-26, Aligned region: 48..163
Protein Sequence: 192 a.a.     [Download]
>gi|134044796|ref|YP_001102169.1| type IV conjugative transfer system protein TraV [Yersinia pestis biovar Orientalis str. IP275]
MKNLNILTRKGSSRGEAQKEQAVRSAKMLGVGAALLILSGCSTFNIGKDEYSCPGMPNGVQCMSARDVYA
ATNDGNVPRPMKPEEVEAKAEADGEGSSNVSANSSSSGDPVIDNYVAPRLPDRPIPIRTPAQVMRIWVAP
WEDTNGDLIVTGYVYTEIEPRRWVIGDGTPQSEPVLRPLQTVQHEPKSETTK
 
Nucleotide Sequence: 579 bp     [Download]
>gi|134044743|ref|NC_009141.1|:75713-76291 Yersinia pestis biovar Orientalis str. IP275 plasmid pIP1202, complete sequence
ATGAAAAATTTGAACATTTTGACCAGAAAGGGCAGTTCCAGAGGCGAGGCTCAAAAGGAACAGGCAGTAA
GATCCGCAAAGATGTTGGGGGTGGGTGCAGCGCTACTTATTTTGTCGGGCTGTTCGACGTTCAACATCGG
CAAGGATGAGTATAGCTGTCCGGGAATGCCGAATGGTGTTCAGTGTATGTCAGCGCGAGACGTTTACGCC
GCAACCAATGACGGAAATGTCCCGCGCCCAATGAAACCAGAGGAAGTCGAGGCCAAAGCGGAAGCGGATG
GCGAAGGTTCCTCAAACGTTTCAGCGAACTCATCTAGCTCCGGAGACCCGGTGATTGACAACTATGTCGC
ACCGCGTCTTCCGGATCGCCCGATTCCAATTCGTACACCAGCACAGGTTATGCGGATTTGGGTAGCTCCC
TGGGAGGACACCAATGGTGATCTCATCGTGACAGGGTATGTCTATACCGAAATCGAACCGCGCAGGTGGG
TGATTGGGGATGGCACACCGCAAAGTGAGCCAGTTTTGAGACCGCTGCAAACGGTACAACACGAACCGAA
GTCTGAAACAACCAAATAG
 Primer design